Clone FI03466 Report

Search the DGRC for FI03466

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:34
Well:66
Vector:pFlc-1
Associated Gene/TranscriptCG13188-RB
Protein status:FI03466.pep: gold
Sequenced Size:2543

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13188 2008-12-18 5.12 accounting

Clone Sequence Records

FI03466.complete Sequence

2543 bp assembled on 2008-10-27

GenBank Submission: BT050452.1

> FI03466.complete
CCTTAGGCGCCCTTACAATTTATGGCAAACTCGTTTCCACACAGCCCAGC
AGCATCGAAAAAGTGAAATTAATAAAGTGAAAAGCAAACGGCAATTGTAG
CAAAAAGGCAATTACAAAATCAATATAAATAATAATAGAAAATCATTGTT
GCAGCATTGATGAAATATACGTACATACATATACGTAAAGAAATAAACAA
CAGTTAGGGGCAAGCACTTTTCCTCGTCGTCGCTCTGCGAATACGTAATC
ATTGGGAAAATATCAGCAATTTTGCAACAGTTTCGTCACAACAACAACAA
CAACAGCAGCAGCAACAGCAACACCAGCGACTGCAGAAAAAAAACAAAAG
TAATTGAGCAGAAAGAGGACAGAGACCCCAGAAATCACACAAAATGGTGT
CGCGTCGAAAAATTCTATCACGTTCCCGCGACGATCTTAATCTCGACCAG
ACGTTCACCCAGCAGGAGGAGGAGGAGGATATCTGGTTCCAGAAGGATAA
ACTATACAAGGAGCACATTCAGGAAGTGCTGGACAAATGGACCCAAATCG
ACGACGAGATCTGGGCCAAAGTGATCGTCTTCGAGCGGAATCGTCGCGTG
GCCAAAGCGTACGCACGCGCCCCAGTGCTGACCATTAATGGATCCGACGA
TGGCTTCGACGGCATGCGAATTGGACTGTGCGGCTTCGACAATCCGATGA
GGGATCAGAAGACCGACGAGATGAAGCGCGTCATCGGACAGGGTGTTAAA
ATCAAAATGGATGACGCTGGGAACATCCTCATCCGGCGGTACGCCAAAAG
CAATGTCTACGTGAAGAGTACCGCCAGCAGTCCCAACGAGGAGACCTCCA
TCGGTGCCGAGATCTTAAAGCTGCCAAATCAGGCGCTCGAATCCGAAAAA
ATAGTCAAGCTCTTCGACATGAAGAAGTTCCAGTCGAATGTGAATCGAGA
ACTGCGTCGCGCCTATCCGGATCGCCGCCGCTTGGAGACGCAGTGCCTCT
CCGCGGTGGCGTTTGTCAAGTCGGAGAACGACATCTTGGAGTGCCCCATC
TGGGTGCTCATCGTTAATGTGGTGGCCATGGATATGCTGAAGAGCAAACT
GCCACCAGTGCAACGTCCCATTGTGGACATCAAGAACCGCCCGCGCATTC
CGATTCCCGACGAGGATCCCTACAGCGTCGCTGGCAACGGAAGTGGCGGT
AGCTCCGGCAGCTCTGGCTTCGGCAGTGGCCACCAGGCGCAACTGCATCC
GCAGCAACAGCTGGGCAAGCATCTCAATGGCAACGGTGGAGGACATGTGG
CCGCCACGCGGGAGCAGCTGCTGCTGCAGACGCAACAACTGGCCCACAAG
CGCAGCGAGAAACCTCCGAAACTACCGCCCAGGGATAATATCTACTCGCA
CGATCTGATTCCAAAGCCGGACTACGATGATATCGATTTGGAGACCCGTA
TCAAACTGTCTCGCGGTAAATCTGACAAGGGCAAAGATAATAAGAAATAT
GATGATCCCTACTACTGCGGCCTGCGGGCCCGAGTTCCGAACTTTGTAAA
GTCCGGCAAGCCGATACCCGCTCAGGTTGCCAAGGATCAGCGGGATGGCA
ATGGGAACAATATCGGGAACGGCGGCATCAGCACGCTCAGCCAGAAGAAA
ACGTCGATGATCCACAACCATTTGGGCGGCATGCATCCCCATCACATTCA
ACAGCAGCAACTGATGGCCGCGGCGGCGGCTGCGCATGCGGCACAGCACC
ACCATGCGGGTCACCAGCGGGAGCAGCAGCAGCACCACCAGATTTGGCAG
ACTCGCAGCTATGAGAGCGGCATAGATTCGGAGCTTGTTGAATCACCCTA
CAATCACATCTACGGACGCCATTTACCGCTGCCAACGCGCGGCTACGTGC
CCACGCCACGCATGTTCATCGGGGAATGGGACTGAGCGTAGTTCACACCG
CACCTGGGCGGGATTTTAGCCGGATTTTGAGCGGCCAAGGCACAAAACAC
ACCACAACACTTGCACATCCCGGCGTGAGAGGGAACGACGCCTACCGTGC
AGAGCTAATTTAAGTCAACCGGCTGCACACAGCTTGAAATATTATTTACA
TTATATTAATTTAGCAAAATATTATGGTAAAATAATATTAGGCTAGGCAT
AAGCAGCAACAAAAAAAACAAGAGTAATCGCAAACCATTGTAACATTTAG
TGCCGTGATTTTTCGCGCTTTTCCCCTAGCAATTTTGAGATTACGCACTT
GAGCCAATTTTGTTTACCCTGTTGTACGAAATGAATGAATAGCCATTACA
TCACGAGTTCAGTTAAGCTTTTAAGTATATTGTAAATTTCTCTTGAGCAG
CCGTCAACTCAACTGGCCTGTTTGCGTATTTACTTGATAAATGTTCTTAA
CTACGAATTTTTCTAGTAAAAACTCAAACAAGCGTTGTCTAACAGGCTGC
TGTTTTTTATTTTATATCTGTAAAATTCTGTAATATTCTGTATTGTGTAT
GCAACGTAATAAAAATAATCTTTTAAAACAAAAAAAAAAAAAA

FI03466.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13188-RB 2917 CG13188-RB 399..2917 13..2531 12595 100 Plus
CG13188-RA 3906 CG13188-RA 399..2211 13..1825 9065 100 Plus
CG8979-RA 1268 CG8979-RA 1063..1268 2531..2326 1030 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7853937..7854652 1823..2529 3410 98.7 Plus
chr2R 21145070 chr2R 7827139..7827491 13..365 1765 100 Plus
chr2R 21145070 chr2R 7851439..7851763 1501..1825 1610 99.7 Plus
chr2R 21145070 chr2R 7849887..7850198 1105..1416 1530 99.4 Plus
chr2R 21145070 chr2R 7849592..7849792 908..1108 1005 100 Plus
chr2R 21145070 chr2R 7849318..7849487 740..909 850 100 Plus
chr2R 21145070 chr2R 7842806..7842965 509..668 785 99.4 Plus
chr2R 21145070 chr2R 7837268..7837415 364..511 740 100 Plus
chr2R 21145070 chr2R 7851209..7851295 1415..1501 435 100 Plus
chr2R 21145070 chr2R 7848899..7848973 668..742 375 100 Plus
chr2R 21145070 chr2R 7793411..7793511 644..544 250 83.2 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG13188-RB 1542 CG13188-PB 1..1542 394..1935 7710 100 Plus
CG13188-RA 3078 CG13188-PA 1..1432 394..1825 7160 100 Plus
CG13183-RA 1296 CG13183-PA 142..413 544..815 325 74.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:33 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG13188-RB 2842 CG13188-RB 326..2842 13..2529 12585 100 Plus
CG13188-RA 4532 CG13188-RA 326..2138 13..1825 9065 100 Plus
CG13188-RA 4532 CG13188-RA 3827..4532 1824..2529 3530 100 Plus
PI31-RF 1172 CG8979-RF 1080..1172 2529..2437 465 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG13188-PB 513 CG13188-PB 1..513 394..1932 2143 100 Plus
CG13188-PA 1025 CG13188-PA 1..477 394..1824 1937 100 Plus
CG13183-PA 431 CG13183-PA 1..369 394..1596 864 47 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11966729..11967437 1823..2531 3545 100 Plus
2R 25286936 2R 11939882..11940234 13..365 1765 100 Plus
2R 25286936 2R 11964231..11964555 1501..1825 1625 100 Plus
2R 25286936 2R 11962670..11962981 1105..1416 1560 100 Plus
2R 25286936 2R 11962375..11962575 908..1108 1005 100 Plus
2R 25286936 2R 11962101..11962270 740..909 850 100 Plus
2R 25286936 2R 11955583..11955742 509..668 800 100 Plus
2R 25286936 2R 11950043..11950190 364..511 740 100 Plus
2R 25286936 2R 11964000..11964086 1415..1501 435 100 Plus
2R 25286936 2R 11961682..11961756 668..742 375 100 Plus
2R 25286936 2R 11906133..11906233 644..544 235 82.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11967928..11968636 1823..2531 3545 100 Plus
2R 25260384 2R 11941081..11941433 13..365 1765 100 Plus
2R 25260384 2R 11965430..11965754 1501..1825 1625 100 Plus
2R 25260384 2R 11963869..11964180 1105..1416 1560 100 Plus
2R 25260384 2R 11963574..11963774 908..1108 1005 100 Plus
2R 25260384 2R 11963300..11963469 740..909 850 100 Plus
2R 25260384 2R 11956782..11956941 509..668 800 100 Plus
2R 25260384 2R 11951242..11951389 364..511 740 100 Plus
2R 25260384 2R 11965199..11965285 1415..1501 435 100 Plus
2R 25260384 2R 11962881..11962955 668..742 375 100 Plus
2R 25260384 2R 11907332..11907432 644..544 235 82.1 Minus
Blast to na_te.dros performed 2014-11-27 11:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..6865 1683..1791 166 63.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6852 1689..1822 160 60.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2304..2455 1681..1822 152 59.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2327..2441 1683..1800 150 62.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2324..2380 1743..1799 123 68.4 Plus

FI03466.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:54:43 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7853940..7854652 1826..2529 98   Plus
chr2R 7851440..7851763 1502..1825 99 -> Plus
chr2R 7851211..7851295 1417..1501 100 -> Plus
chr2R 7849891..7850198 1109..1416 99 -> Plus
chr2R 7849594..7849792 910..1108 100 -> Plus
chr2R 7849320..7849487 742..909 100 -> Plus
chr2R 7848900..7848972 669..741 100 -> Plus
chr2R 7842808..7842965 511..668 99 -> Plus
chr2R 7837270..7837414 366..510 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:40:58 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 1..1542 394..1935 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:16:54 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 1..1542 394..1935 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:07 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 1..1542 394..1935 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:54:43 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 1..1542 394..1935 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:40:57 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 399..2915 13..2529 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:16:54 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 399..2915 13..2529 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:07 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 326..2842 13..2529 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-27 09:48:34 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 399..2915 13..2529 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:54:43 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
CG13188-RB 326..2842 13..2529 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:54:43 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11966732..11967435 1826..2529 100   Plus
2R 11964232..11964555 1502..1825 100 -> Plus
2R 11964002..11964086 1417..1501 100 -> Plus
2R 11962674..11962981 1109..1416 100 -> Plus
2R 11962377..11962575 910..1108 100 -> Plus
2R 11962103..11962270 742..909 100 -> Plus
2R 11961683..11961755 669..741 100 -> Plus
2R 11955585..11955742 511..668 100 -> Plus
2R 11950045..11950189 366..510 100 -> Plus
2R 11939882..11940234 13..365 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:07 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7854237..7854940 1826..2529 100   Plus
arm_2R 7851737..7852060 1502..1825 100 -> Plus
arm_2R 7851507..7851591 1417..1501 100 -> Plus
arm_2R 7850179..7850486 1109..1416 100 -> Plus
arm_2R 7849882..7850080 910..1108 100 -> Plus
arm_2R 7849608..7849775 742..909 100 -> Plus
arm_2R 7849188..7849260 669..741 100 -> Plus
arm_2R 7843090..7843247 511..668 100 -> Plus
arm_2R 7837550..7837694 366..510 100 -> Plus
arm_2R 7827387..7827739 13..365 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:47:56 Download gff for FI03466.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11967931..11968634 1826..2529 100   Plus
2R 11965431..11965754 1502..1825 100 -> Plus
2R 11965201..11965285 1417..1501 100 -> Plus
2R 11963873..11964180 1109..1416 100 -> Plus
2R 11963576..11963774 910..1108 100 -> Plus
2R 11963302..11963469 742..909 100 -> Plus
2R 11962882..11962954 669..741 100 -> Plus
2R 11956784..11956941 511..668 100 -> Plus
2R 11951244..11951388 366..510 100 -> Plus
2R 11941081..11941433 13..365 100 -> Plus

FI03466.pep Sequence

Translation from 393 to 1934

> FI03466.pep
MVSRRKILSRSRDDLNLDQTFTQQEEEEDIWFQKDKLYKEHIQEVLDKWT
QIDDEIWAKVIVFERNRRVAKAYARAPVLTINGSDDGFDGMRIGLCGFDN
PMRDQKTDEMKRVIGQGVKIKMDDAGNILIRRYAKSNVYVKSTASSPNEE
TSIGAEILKLPNQALESEKIVKLFDMKKFQSNVNRELRRAYPDRRRLETQ
CLSAVAFVKSENDILECPIWVLIVNVVAMDMLKSKLPPVQRPIVDIKNRP
RIPIPDEDPYSVAGNGSGGSSGSSGFGSGHQAQLHPQQQLGKHLNGNGGG
HVAATREQLLLQTQQLAHKRSEKPPKLPPRDNIYSHDLIPKPDYDDIDLE
TRIKLSRGKSDKGKDNKKYDDPYYCGLRARVPNFVKSGKPIPAQVAKDQR
DGNGNNIGNGGISTLSQKKTSMIHNHLGGMHPHHIQQQQLMAAAAAAHAA
QHHHAGHQREQQQHHQIWQTRSYESGIDSELVESPYNHIYGRHLPLPTRG
YVPTPRMFIGEWD*

FI03466.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13107-PA 513 GF13107-PA 1..513 1..513 2125 88.2 Plus
Dana\GF11799-PA 433 GF11799-PA 1..431 1..476 861 41.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20231-PA 516 GG20231-PA 1..516 1..513 2297 95.3 Plus
Dere\GG22620-PA 431 GG22620-PA 1..429 1..476 914 42.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21480-PA 522 GH21480-PA 1..522 1..513 2124 86.7 Plus
Dgri\GH20403-PA 436 GH20403-PA 1..354 1..389 864 46.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:51:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13188-PB 513 CG13188-PB 1..513 1..513 2718 100 Plus
CG13188-PA 1025 CG13188-PA 1..477 1..477 2512 100 Plus
CG13183-PA 431 CG13183-PA 1..425 1..472 913 43.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19958-PA 521 GI19958-PA 1..521 1..513 2120 84.6 Plus
Dmoj\GI19590-PA 447 GI19590-PA 1..356 1..389 881 45 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10094-PA 518 GL10094-PA 1..518 1..513 2172 89.1 Plus
Dper\GL10242-PA 432 GL10242-PA 1..355 1..389 871 46.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25074-PA 518 GA25074-PA 1..518 1..513 2172 89.1 Plus
Dpse\GA25074-PB 1038 GA25074-PB 1..482 1..477 1979 88.3 Plus
Dpse\GA12100-PA 432 GA12100-PA 1..355 1..389 869 46.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21319-PA 515 GM21319-PA 1..515 1..513 2357 96.5 Plus
Dsec\GM20400-PA 431 GM20400-PA 1..369 1..401 898 46.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10827-PA 515 GD10827-PA 1..515 1..513 2304 96.7 Plus
Dsim\GD25874-PA 431 GD25874-PA 1..369 1..401 905 47.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:51:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17909-PA 518 GJ17909-PA 1..518 1..513 2195 88 Plus
Dvir\GJ18369-PA 431 GJ18369-PA 1..351 1..389 880 45.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22050-PA 518 GK22050-PA 1..518 1..513 2186 84.1 Plus
Dwil\GK22250-PA 442 GK22250-PA 1..356 1..389 863 48.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12392-PA 514 GE12392-PA 1..514 1..513 2316 99 Plus
Dyak\GE13489-PA 431 GE13489-PA 1..429 1..476 908 42 Plus

FI03466.hyp Sequence

Translation from 393 to 1934

> FI03466.hyp
MVSRRKILSRSRDDLNLDQTFTQQEEEEDIWFQKDKLYKEHIQEVLDKWT
QIDDEIWAKVIVFERNRRVAKAYARAPVLTINGSDDGFDGMRIGLCGFDN
PMRDQKTDEMKRVIGQGVKIKMDDAGNILIRRYAKSNVYVKSTASSPNEE
TSIGAEILKLPNQALESEKIVKLFDMKKFQSNVNRELRRAYPDRRRLETQ
CLSAVAFVKSENDILECPIWVLIVNVVAMDMLKSKLPPVQRPIVDIKNRP
RIPIPDEDPYSVAGNGSGGSSGSSGFGSGHQAQLHPQQQLGKHLNGNGGG
HVAATREQLLLQTQQLAHKRSEKPPKLPPRDNIYSHDLIPKPDYDDIDLE
TRIKLSRGKSDKGKDNKKYDDPYYCGLRARVPNFVKSGKPIPAQVAKDQR
DGNGNNIGNGGISTLSQKKTSMIHNHLGGMHPHHIQQQQLMAAAAAAHAA
QHHHAGHQREQQQHHQIWQTRSYESGIDSELVESPYNHIYGRHLPLPTRG
YVPTPRMFIGEWD*

FI03466.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13188-PB 513 CG13188-PB 1..513 1..513 2718 100 Plus
CG13188-PA 1025 CG13188-PA 1..477 1..477 2512 100 Plus
CG13183-PA 431 CG13183-PA 1..425 1..472 913 43.5 Plus