Clone FI03495 Report

Search the DGRC for FI03495

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:34
Well:95
Vector:pFlc-1
Associated Gene/TranscriptTom70-RA
Protein status:FI03495.pep: gold
Sequenced Size:2273

Clone Sequence Records

FI03495.complete Sequence

2273 bp assembled on 2009-07-08

GenBank Submission: BT088913.1

> FI03495.complete
ATTCACAGTGCCGTTATTACTCCATACCTATCGATGTCTATCGTTTTTCG
ATGTCGTGTGCTCAGCAGGCTGATATACAATAGAATCTAAGTTTCCCGAG
TTCTAACTGAAAATAGAACAATCGACGTTTAACAATTGCCAAATTCACAG
CAGTGTAAAGTTTTAAAAAAGTTTCATCACACATAACACACATCCATAAA
AAGACCGGCTCAATGGCGATGACTCTGAACATTGGCTCGATGAAGCTGAC
AAAGTGGCAGCTGGCGCTCATCCTTGGAACTCCCCTGGCCATTGGACTGG
GCACCTATGCGGTGAAGAGCTGGACGGCTGCGTCCAAGGAGTTGGACGGG
GAGAAGAAGAGACCAAAGGCCAAGATCGAGAAGCAGGCCATCTCCCTGGA
CGGCACCGCACCGGACCAGGAGCTAGAGCGCAATCAAAAGTCCGCTGAGC
TGGGCGAGAAGCTGTCGCCTCTTAAGGAGGCCAACAACTACAAGACGGAG
GGTAACAACTGCTACAGGAATGGGAAGTACGATGAGGCCATTAAATTCTA
TGACAAGGCCATCGACAAGTGTCCCAAGGAGCACCGCACTGACATGGCCA
TCTTCTACCAGAACCGCGCCGCCTCTTACGAGATGCTCAAGAAGTGGTCC
AACGTCAAGGAGGACTGCACAGCCTCGCTGGAGTTCAATCCTCGTTACGC
CAAGGCATATTATCGTCGTGCCCGTGCTCACGAAGCCACCAAGGATATGA
ACGAGTGCTTGGACGATGTCACAGCCACCTGTATCCTGGAGATGTTCCAA
AATAATCAAACTATCATGTTCGCTGACCGTGTGCTCAAGGAGACCGGCCG
ACTGGACGCCGAGAAGGGTATGCGCAATCGGGTGCCAGTCGTGCCGTCGG
CTTGCTTCGTAAACACCTACACGCGTTCCTTCATCGCGGATCCGCTGCAG
ACCATGAAAGTCCCAGCCCCTAAATCCGATGCACCCCCAAAGGGTTTCCT
GCGCGCCCACCTCGCTTTCCTCGAGGAGAAGTACGAGGAAATTATTCCCG
CCTGCACCGAAGAGATCGAATCCTCCGAGGCCGAAGCACAGTACAAAGTG
GAGGCTCTGCTTATGCGGGGAACTTTCCATCTGCTGTGCGGCTCCTATGT
AGAAAGCCAGCAGGACTTTGATGCTATTATAGCTAATGACTATGCTGATC
CCAACTTGCGTGCGTATGCCTACATAAAGCGGGCAGCTCTCTACATCCAG
CTGGATCAGCGCGAAAAGGGTATAGCCGATTTTGCTGAGGCGGAACGCCT
GAACCCAGAGAACCCAGATGTGTACCACCAGCGCGCCCAGATACTTCTGC
TGCTGGAGCAGATAGAGCCCGCCTTGGCCGAGTTCGAAAAGGCGGTGAGC
ATTGCACCCAACCACGCCATCGCCTTCGTCCAGAAGTGCTATGCCGAGTA
CCGACTATCCCTCCTGGCCGGCGACCAGCGGCGCTTGGAGAGCGTAATGC
ACACCTTCCAAAATGCCATCGAGCGTTTCCCGAGCTGCGTTGAGTGCTAT
AGTCTAACGGCTCAGGTGTTGGCCGACCAGCAACAGTTTACCCAGGCGGA
GGAATACTACAAAAAGGCCATGGTATTGGCGCCAACAAATCCTGCACTTA
TCGTTCACCAGGCCATCATGGTGCTTCAGTGGCGCGGAGACATTAATTTG
GCTGTCCAGCTGCTCAACAAGGCGATCGAAGTAGATCCCAAATGCGAGCT
GGCCTACGAGACACTCGGAACAGTCGAAGTTCAGCGGGCGCAACTCACAC
GGGCCGTCGAGCTTTTTGAAAAGGCACTGCTTTATGCCAAGAGTCAGGCG
GAGTTGGTGCACGTTTACTCGCTGCGCAACGCGGCAGTGGCCCAAATCAA
CGTCACCAAAAAGCTGGGTATCGACATGAACTCAGTGTCGGCAATGGCCC
AATCCGGATTGATGGCCCAGGGCGTTGCATAGAGTATGAAACCGGTGTGT
GTTGGGATTGATATCCCGAGAAAATAAGAGCCAGCGCGGAGCATTTAGCC
AGCAGTCCTACTCTAATTAAGTTAATATCGACCATACCTGTTATTTATAT
ATATATATATAAAGCTTGTTTACGTTTATGCTCCTAGCTTTAGCATAGAA
ATTGTCATGTATTATGGTACATATGTAAACTAGAATCTGTTGCCTAAGGA
ATCCACTAAGACAAATCCAGTAGCTTATGTTTAAGCGTAAGATTAAACTT
AAAAAAATAAAAAAAAAAAAAAA

FI03495.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
Tom70-RA 2323 Tom70-RA 33..2286 1..2254 11255 99.9 Plus
Tom70-RB 2288 Tom70-RB 170..2251 173..2254 10410 100 Plus
CG18788-RB 1816 CG18788-RB 1678..1816 2254..2116 695 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12034687..12035753 2254..1188 5335 100 Minus
chr2L 23010047 chr2L 12035843..12036855 1188..176 5050 99.9 Minus
chr2L 23010047 chr2L 12037060..12037231 172..1 845 99.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
Tom70-RC 1770 CG6756-PC 1..1770 213..1982 8850 100 Plus
Tom70-RB 1770 CG6756-PB 1..1770 213..1982 8850 100 Plus
Tom70-RA 1770 CG6756-PA 1..1770 213..1982 8850 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
Tom70-RA 2218 CG6756-RA 1..2218 33..2250 11090 100 Plus
Tom70-RB 2237 CG6756-RB 141..2222 173..2254 10410 100 Plus
Tom70-RC 2297 CG6756-RC 220..2297 173..2250 10390 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
Tom70-PC 589 CG6756-PC 1..589 213..1979 2941 100 Plus
Tom70-PB 589 CG6756-PB 1..589 213..1979 2941 100 Plus
Tom70-PA 589 CG6756-PA 1..589 213..1979 2941 100 Plus
unc-45-PA 947 CG2708-PA 10..109 471..776 175 42.2 Plus
sxc-PB 1059 CG10392-PB 155..363 1221..1886 166 25.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12035999..12037065 2254..1188 5335 100 Minus
2L 23513712 2L 12037155..12038170 1188..173 5080 100 Minus
2L 23513712 2L 12038372..12038543 172..1 845 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12035999..12037065 2254..1188 5335 100 Minus
2L 23513712 2L 12037155..12038170 1188..173 5080 100 Minus
2L 23513712 2L 12038372..12038543 172..1 845 99.4 Minus
Blast to na_te.dros performed on 2014-11-26 23:15:19 has no hits.

FI03495.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:26:35 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12037060..12037231 1..172 99   Minus
chr2L 12035843..12036858 173..1188 99 <- Minus
chr2L 12034683..12035752 1189..2258 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:49:31 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
Tom70-RC 1..1770 213..1982 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:07 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
Tom70-RC 1..1770 213..1982 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:30 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
Tom70-RA 1..1770 213..1982 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:26:35 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
Tom70-RA 1..1770 213..1982 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-08 10:10:20 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
Tom70-RA 1..2250 1..2250 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:07 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
Tom70-RA 1..2250 1..2250 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:30 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
Tom70-RA 1..2218 33..2250 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:26:35 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
Tom70-RA 1..2218 33..2250 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:26:35 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12038372..12038543 1..172 99   Minus
2L 12037155..12038170 173..1188 100 <- Minus
2L 12035995..12037064 1189..2258 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:30 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12038372..12038543 1..172 99   Minus
arm_2L 12037155..12038170 173..1188 100 <- Minus
arm_2L 12035995..12037064 1189..2258 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:27:08 Download gff for FI03495.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12038372..12038543 1..172 99   Minus
2L 12037155..12038170 173..1188 100 <- Minus
2L 12035995..12037064 1189..2258 99 <- Minus

FI03495.pep Sequence

Translation from 212 to 1981

> FI03495.pep
MAMTLNIGSMKLTKWQLALILGTPLAIGLGTYAVKSWTAASKELDGEKKR
PKAKIEKQAISLDGTAPDQELERNQKSAELGEKLSPLKEANNYKTEGNNC
YRNGKYDEAIKFYDKAIDKCPKEHRTDMAIFYQNRAASYEMLKKWSNVKE
DCTASLEFNPRYAKAYYRRARAHEATKDMNECLDDVTATCILEMFQNNQT
IMFADRVLKETGRLDAEKGMRNRVPVVPSACFVNTYTRSFIADPLQTMKV
PAPKSDAPPKGFLRAHLAFLEEKYEEIIPACTEEIESSEAEAQYKVEALL
MRGTFHLLCGSYVESQQDFDAIIANDYADPNLRAYAYIKRAALYIQLDQR
EKGIADFAEAERLNPENPDVYHQRAQILLLLEQIEPALAEFEKAVSIAPN
HAIAFVQKCYAEYRLSLLAGDQRRLESVMHTFQNAIERFPSCVECYSLTA
QVLADQQQFTQAEEYYKKAMVLAPTNPALIVHQAIMVLQWRGDINLAVQL
LNKAIEVDPKCELAYETLGTVEVQRAQLTRAVELFEKALLYAKSQAELVH
VYSLRNAAVAQINVTKKLGIDMNSVSAMAQSGLMAQGVA*

FI03495.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15495-PA 596 GF15495-PA 1..596 1..588 2540 82.4 Plus
Dana\GF17806-PA 946 GF17806-PA 11..108 89..188 180 39 Plus
Dana\GF16515-PA 266 GF16515-PA 76..199 79..196 172 33.1 Plus
Dana\GF11378-PA 505 GF11378-PA 95..195 88..193 154 35.8 Plus
Dana\GF13981-PA 396 GF13981-PA 155..358 336..547 152 25.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10284-PA 590 GG10284-PA 1..590 1..589 2867 92.4 Plus
Dere\GG14374-PA 947 GG14374-PA 10..109 87..188 192 39.2 Plus
Dere\GG19960-PA 267 GG19960-PA 85..189 82..185 168 37.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13778-PA 599 GH13778-PA 1..599 1..586 2339 76 Plus
Dgri\GH17296-PA 948 GH17296-PA 17..111 92..188 172 39.2 Plus
Dgri\GH18243-PA 281 GH18243-PA 74..203 56..185 150 31.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Tom70-PC 589 CG6756-PC 1..589 1..589 3015 100 Plus
Tom70-PB 589 CG6756-PB 1..589 1..589 3015 100 Plus
Tom70-PA 589 CG6756-PA 1..589 1..589 3015 100 Plus
unc-45-PA 947 CG2708-PA 10..109 87..188 211 42.2 Plus
CG14894-PB 263 CG14894-PB 65..189 61..185 173 29.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17182-PA 598 GI17182-PA 1..596 1..587 2440 77.7 Plus
Dmoj\GI10261-PA 954 GI10261-PA 21..115 92..188 174 39.2 Plus
Dmoj\GI10199-PA 281 GI10199-PA 55..203 33..185 169 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14152-PA 586 GL14152-PA 1..580 3..580 2202 70.9 Plus
Dper\GL26762-PA 534 GL26762-PA 1..530 1..583 1252 45.2 Plus
Dper\GL16436-PA 585 GL16436-PA 8..576 13..583 1084 39.7 Plus
Dper\GL16562-PA 569 GL16562-PA 3..561 10..571 967 38.5 Plus
Dper\GL21360-PA 453 GL21360-PA 6..406 61..451 906 45.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:37:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19838-PA 586 GA19838-PA 1..580 3..580 2207 71 Plus
Dpse\GA23045-PA 554 GA23045-PA 1..550 1..583 1338 46.5 Plus
Dpse\GA23692-PA 542 GA23692-PA 7..527 62..570 1106 42.6 Plus
Dpse\GA22574-PA 583 GA22574-PA 8..576 13..585 1086 39.3 Plus
Dpse\GA23101-PA 571 GA23101-PA 3..563 10..571 981 38.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26429-PA 589 GM26429-PA 1..589 1..589 3108 98.1 Plus
Dsec\GM10996-PA 947 GM10996-PA 10..109 87..188 193 40.2 Plus
Dsec\GM15432-PA 267 GM15432-PA 85..189 82..185 151 35.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22142-PA 589 GD22142-PA 1..589 1..589 3109 98.1 Plus
Dsim\GD19966-PA 947 GD19966-PA 10..109 87..188 192 40.2 Plus
Dsim\GD20288-PA 267 GD20288-PA 85..189 82..185 152 35.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22149-PA 597 GJ22149-PA 1..595 1..587 2416 78.4 Plus
Dvir\GJ11067-PA 947 GJ11067-PA 11..108 89..188 171 38 Plus
Dvir\GJ23487-PA 283 GJ23487-PA 110..205 90..185 159 34.4 Plus
Dvir\GJ20216-PA 536 GJ20216-PA 103..203 88..193 156 34.9 Plus
Dvir\GJ20442-PA 1050 GJ20442-PA 145..362 336..570 155 25.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14555-PA 598 GK14555-PA 1..596 1..587 2449 78.1 Plus
Dwil\GK13474-PA 949 GK13474-PA 12..139 90..222 188 31.6 Plus
Dwil\GK14066-PA 277 GK14066-PA 76..199 67..185 161 34.4 Plus
Dwil\GK23037-PA 482 GK23037-PA 98..231 88..228 161 32.6 Plus
Dwil\GK21381-PA 1059 GK21381-PA 151..360 336..558 157 26.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12522-PA 590 GE12522-PA 1..590 1..589 2891 93.2 Plus
Dyak\GE24964-PA 947 GE24964-PA 10..109 87..188 188 39.2 Plus

FI03495.hyp Sequence

Translation from 212 to 1981

> FI03495.hyp
MAMTLNIGSMKLTKWQLALILGTPLAIGLGTYAVKSWTAASKELDGEKKR
PKAKIEKQAISLDGTAPDQELERNQKSAELGEKLSPLKEANNYKTEGNNC
YRNGKYDEAIKFYDKAIDKCPKEHRTDMAIFYQNRAASYEMLKKWSNVKE
DCTASLEFNPRYAKAYYRRARAHEATKDMNECLDDVTATCILEMFQNNQT
IMFADRVLKETGRLDAEKGMRNRVPVVPSACFVNTYTRSFIADPLQTMKV
PAPKSDAPPKGFLRAHLAFLEEKYEEIIPACTEEIESSEAEAQYKVEALL
MRGTFHLLCGSYVESQQDFDAIIANDYADPNLRAYAYIKRAALYIQLDQR
EKGIADFAEAERLNPENPDVYHQRAQILLLLEQIEPALAEFEKAVSIAPN
HAIAFVQKCYAEYRLSLLAGDQRRLESVMHTFQNAIERFPSCVECYSLTA
QVLADQQQFTQAEEYYKKAMVLAPTNPALIVHQAIMVLQWRGDINLAVQL
LNKAIEVDPKCELAYETLGTVEVQRAQLTRAVELFEKALLYAKSQAELVH
VYSLRNAAVAQINVTKKLGIDMNSVSAMAQSGLMAQGVA*

FI03495.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Tom70-PC 589 CG6756-PC 1..589 1..589 3015 100 Plus
Tom70-PB 589 CG6756-PB 1..589 1..589 3015 100 Plus
Tom70-PA 589 CG6756-PA 1..589 1..589 3015 100 Plus
unc-45-PA 947 CG2708-PA 10..109 87..188 211 42.2 Plus
CG14894-PB 263 CG14894-PB 65..189 61..185 173 29.6 Plus