Clone FI03626 Report

Search the DGRC for FI03626

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:26
Vector:pOT2
Associated Gene/TranscriptCG1317-RB
Protein status:FI03626.pep: gold
Sequenced Size:3664

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1317 2008-12-18 5.12 accounting

Clone Sequence Records

FI03626.complete Sequence

3664 bp assembled on 2008-09-02

GenBank Submission: BT044149.1

> FI03626.complete
TTTGAGAAGTAGTCTTGTTTTGTTTTGTCGTAATAATATCCCAACTTTTC
GGTTAAAATTCAAGTGTTACAATCGCATTACGGTCCGTAATCATCGAAAG
GTTAATTGGCGCACATAAAAGGCGGGTATAATCGTCTTAAAACCCCCGTA
CCCTCGGGTCAATTACGGAAATTGTCCAGCGAATTTCGCAAATGACCAGT
GGAACTTTAGTAATTCAGTCAAACTGAAGACCCAGGATCCGGGAAAAAGT
TATCAGTATGGACGACCTGTCGCAGGGCGACATTTGCCGCGTGTGCAGAT
GCGAGGCACAGCCGGATAGGCCTCTTTTCTACCCGTGCATCTGCACTGGA
TCGATCAAGTACATTCATCAGGACTGCCTGATGTTATGGATGCGCTACTC
GCACAAGGAATACTGCGAGCTGTGCAGCTACAGCTTCAGCTTTCAGCCCA
TCTATGCTCCGGATATGCCGCGAGTCCTGCCGATAAAGGATGTCCTTGTG
GGACTGATGTCCGCCGTTTTGGAGGGCGCTCGCTGCTGGCTTCATTACAC
CCTGGTCGGTTTGGCCTGGTTCGGAGTGGTGCCGCTGTCTGCCTACAGGA
CCTATCGGTACCTCTTCCGGGCGAGCTCCTTCGATATGATTCTCACGCTG
CCCTTTGACATCTTCTCCGTTGAAAACCTGGCATCGGATGCCTTTCGGGG
CTGTTTTGTGGTCACATGCACACTTTTGTCCTTCATAGGATTGGTCTGGC
TGCGCGAGCAGATCCTGCATGGCGGCGGACCCGATTGGCTGGAGCGGGAC
GATGCCCCTCTACAGGCAGCGGCTGCTAATCCTGCGCCTGATCCCGCCGC
CGAGGCAGCTCCACAGCCTCAGGACGACAACAACAATGCCGACGACAATG
AAGCGCCGGCTCCAGCGGACAACGATGGGCAGGATGCCCAGGCCCAGGAT
GCCGCACCAGCGGCTGCAGCTCCCGTCGTGGACGCCGATGCCGATGAGCA
GAATTGGAATCCCATGGAGTGGGATCGGGCTGCCGAGGAGCTTACCTGGG
AACGCCTGCTCGGACTCGATGGCTCGCTAGTTTTTCTGGAGCACGTCTTC
TGGATCATCTCACTGAACACCATGTTCATCTTCACCTTCGCCTTTTGTCC
CTACTGCGTGGGCAACTTCATTCTGAGCTCCATGGATCTTTTGCAGCCCG
AGAAACCACTGCTACACTTTCACGGCCTGATTACCACGCTATTTGGTTAC
TGCTGCATTGGATTGACCCTGGTGGTGCTGCACTTCTTCTCCAGAGTTTT
CCGCCTGCGGAGAGTCTGCTGGTTCATTGGATTGTGCTATATTGTGGTCA
AGGTGTCGCTGCTGTCGGTGTTGGAGATCGGAGTACTCCCGCTGATTTGC
GGCTGGTGGCTGGACATTTGTTCGTTGCCCCTACTAGATGCCAGCCTCAA
GGATCGTAAAGAGAGTTTTAAGGCTGCTCCGGGCACCTCACTTTTTGTCC
ACTGGATGTTTGGCATGGTATACGTTTACTACTTCGCTGCGTTTGTATCG
TTGTTGCGCGAGGTGCTGCGACCGGGAGTGCTCTGGATATTCCGCAATGT
CAACGATCCTGACTTCAGTCCCATCCAGGAAATGATCCATGTACCAATTG
TGAGACACATCCGGCGGCTGGTCGCTTCGGCTATGATCTTTGGATTTGCA
GTGCTCTTGATGCTCTGGCTGCCCATTAGAATTCTGCAGGTGGTTTGTCC
GGACTTCTTGCCATATGCACTTAGTGGCGATTCAGCGGTTAACTTGCAAT
TGCTGCTCTTACAAATCGTTTTGCCGGGCTTCTTCGAGCAGACCCAAACA
CGCATCTGGCTAAAGGGCTTGCTGCGCATTTGGTGCACAGCGGTGGCCTG
GTTGCTGGGCATACGAAGCTACCTGCTCCCAGCACCGGAGCCGGAACCGG
AAATTCCCGCTGCTGGAGAAGAAGGCGTGGAGAATGCCGCTGGCGAAAAT
GAAAACCAGGAAGGTGAGGCAGCGGATGCGGCAGCCCAACCACCAGCACC
ACCTCCTCCACCGCCACCGCCAGTGGAACCGGCGCCGGCACCACGAAACC
TTGCCGCCGCCCATCAGGCCATCATGCAACGGGATGCACCCGTGGGATTC
CAGCCGTACGACAAGCCATCGCTGTTCGCTTTACGTTTGTGTGCCCTGTT
GGCACTCATGTGTTTGTCCATCGTTTGTGCTGCCATGTTGACGCTCACGG
TTCCAGTCTACATCGGTCGGCGGCTGATGTTGATCTGGTCCTCCCAGCCG
GATGAGAAGGCAGCTGGAGCGGCAGCCGCAGAAGGAGCGGGCGAAGTGGT
TGAAAATCTAGATCCAATCGATCCGGAAGGAGCCAGAAAGAACGAGCGAC
TACTGCGCTCGCATGAGCTGTACACCGCTGAGCTTGGTGGTTACCTGTGC
TGGATTGTCTGCCGGGTAGTAGCTGCGGTGGTCACCCTGCTGCCACAAGG
CCGCGCGGCTATTGTCGACAAGATAAAGCACTGGGTCCGAGTGGCATTGC
AATATGCCCTGCCCGTTCTAACACTCCTGGGAATCTTCGTGCTGGTTCCG
TTGCTGATTGGATTGCTGATCGAGTTGGCGGTGGTCATTCCCCTACGCGT
TCCACTACGCAAGACACCAATCCACTTCCTATGGGAGGATTGGGCGCTGG
GAGTGCTCTACTGCAAGATAGCCATCGCCTTGACGATGATGGGCCCAGAT
TGGCACTTGAAGCGTGCATTAGATCGAGCCTACATGGATGGATTGCGCGA
TTTCGACTTGAAGTTTGTGATGCGAGACTTGGCTGTGCCGGTCGTTACTA
CCATTGGTCTGGCCCTGGCCATACCCTATGTCATGGCACATATGATGTTT
CCGATTTTCCTAGCGGACGCCTATGCTCAGCATGTCGTCGCACGGCTCGT
GTATCCCGTAAGCTTCATTGTGGTGGGCAGCATATGCATCCTTTTGTTCC
AGATCGATCAGCTGAAGAAGCTCTATCTGTCCATCAAGGTGGATAAGTAC
CTGGTGGGTCAGAGGCTGGTCAACTATGAGCACCGCAAGAAGCAGCAACA
GCAGCAGGAGGAGGAGAAGGAGCAACAGCGGGCGGCCCGGGAATTAAGGG
AGAACCAGGAGAGAGATCGGGAGCGAGAGCGGGAACAGTTGGTCCAGGAG
CTCGAGTTGGCTGAACTTCTGTAACGAGATCAGATTTTTATTTCAACCCG
ACAAGGAGAAGGACACCAGAATGTTGAAGCCGTTGAAGTATTCGTCGTGC
TTTTTCGTCGTGGAGATGCTTCTGCTGCTAATATATATCCCCTGTTTAGT
ATCTATTGCTCTGCGTTACGCAAGGATTTGGATTTGGATTTCGTTATAGC
TTAGTACCTTTGTTTTCCCAATCTTATTATCCTTTGCAATACGATTAATT
TGTTAGCTGCAATTGTTGTTAAATCCTTACGCTGCACAGTTTATAGATCC
TAAGTTGTATGATATTTTGACTTCCGCCACATCCTTACAAGCACTTACAG
AACTAAACGATGGGCAGCGATTAAACCTTGTATTAGAGACGTATGCAGAA
ACTACATCTGAGAGTTGTCAACTTTAGGAACTTTAGAGAAACCCCAAAAA
AAAAAAAAAAAAAA

FI03626.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG1317-RC 3820 CG1317-RC 48..3707 1..3660 18300 100 Plus
CG1317-RB 3966 CG1317-RB 48..3280 1..3233 16165 100 Plus
CG1317.a 3696 CG1317.a 42..3274 1..3233 16165 100 Plus
CG1317-RB 3966 CG1317-RB 3483..3911 3232..3660 2145 100 Plus
CG1317.a 3696 CG1317.a 3284..3696 3234..3646 2065 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2369539..2371352 1814..1 8905 99.4 Minus
chr3L 24539361 chr3L 2368063..2369481 3233..1815 7020 99.6 Minus
chr3L 24539361 chr3L 2367447..2367860 3645..3232 2025 99.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG1317-RD 2967 CG1317-PD 1..2967 258..3224 14835 100 Plus
CG1317-RC 2967 CG1317-PC 1..2967 258..3224 14835 100 Plus
CG1317-RB 2967 CG1317-PB 1..2967 258..3224 14835 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:46 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG1317-RD 3836 CG1317-RD 21..3665 1..3645 18225 100 Plus
CG1317-RC 3665 CG1317-RC 21..3665 1..3645 18225 100 Plus
CG1317-RB 3869 CG1317-RB 21..3253 1..3233 16165 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG1317-PD 988 CG1317-PD 247..940 996..3077 2941 100 Plus
CG1317-PC 988 CG1317-PC 247..940 996..3077 2941 100 Plus
CG1317-PB 988 CG1317-PB 247..940 996..3077 2941 100 Plus
CG1317-PD 988 CG1317-PD 1..180 258..797 993 100 Plus
CG1317-PC 988 CG1317-PC 1..180 258..797 993 100 Plus
CG1317-PB 988 CG1317-PB 1..180 258..797 993 100 Plus
CG4080-PB 617 CG4080-PB 38..93 270..437 194 51.8 Plus
CG4080-PA 617 CG4080-PA 38..93 270..437 194 51.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2370106..2371919 1814..1 9070 100 Minus
3L 28110227 3L 2368630..2370048 3233..1815 7095 100 Minus
3L 28110227 3L 2367999..2368427 3660..3232 2145 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2370106..2371919 1814..1 9070 100 Minus
3L 28103327 3L 2368630..2370048 3233..1815 7095 100 Minus
3L 28103327 3L 2367999..2368427 3660..3232 2145 100 Minus
Blast to na_te.dros performed 2014-11-27 09:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6747..6853 3079..3188 147 60.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6877 3073..3233 141 57.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6789..6839 3079..3129 138 74.5 Plus
roo 9092 roo DM_ROO 9092bp 1068..1141 3088..3161 136 64.9 Plus
roo 9092 roo DM_ROO 9092bp 1067..1133 3060..3129 135 70 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2290..2364 3054..3129 134 65.8 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 865..1010 2981..3131 132 58.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2340..2397 3071..3129 130 71.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6768..6818 3079..3129 129 72.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2319..2378 3071..3131 122 68.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6834..6877 3088..3131 121 75 Plus
roo 9092 roo DM_ROO 9092bp 1095..1145 3079..3129 120 70.6 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 633..723 3175..3089 120 63.7 Minus

FI03626.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:25:00 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2369539..2371352 1..1814 99   Minus
chr3L 2368063..2369481 1815..3233 96 <- Minus
chr3L 2367447..2367858 3234..3645 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:44:45 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RB 1..2967 258..3224 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:08:36 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RC 1..2967 258..3224 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:30:45 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RB 1..2967 258..3224 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:17:47 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RB 1..2967 258..3224 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:25:00 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RB 1..2967 258..3224 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:06:02 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RB 42..3274 1..3233 100 -> Plus
CG1317-RB 3479..3890 3234..3645 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:08:35 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RC 42..3686 1..3645 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:30:45 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RC 21..3665 1..3645 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-02 10:21:05 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RB 42..3274 1..3233 100 -> Plus
CG1317-RB 3479..3890 3234..3645 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:25:00 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
CG1317-RC 21..3665 1..3645 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:25:00 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2370106..2371919 1..1814 100   Minus
3L 2368630..2370048 1815..3233 100 <- Minus
3L 2368014..2368425 3234..3645 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:30:45 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2370106..2371919 1..1814 100   Minus
arm_3L 2368630..2370048 1815..3233 100 <- Minus
arm_3L 2368014..2368425 3234..3645 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:00:46 Download gff for FI03626.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2370106..2371919 1..1814 100   Minus
3L 2368630..2370048 1815..3233 100 <- Minus
3L 2368014..2368425 3234..3645 100 <- Minus

FI03626.pep Sequence

Translation from 257 to 3223

> FI03626.pep
MDDLSQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHK
EYCELCSYSFSFQPIYAPDMPRVLPIKDVLVGLMSAVLEGARCWLHYTLV
GLAWFGVVPLSAYRTYRYLFRASSFDMILTLPFDIFSVENLASDAFRGCF
VVTCTLLSFIGLVWLREQILHGGGPDWLERDDAPLQAAAANPAPDPAAEA
APQPQDDNNNADDNEAPAPADNDGQDAQAQDAAPAAAAPVVDADADEQNW
NPMEWDRAAEELTWERLLGLDGSLVFLEHVFWIISLNTMFIFTFAFCPYC
VGNFILSSMDLLQPEKPLLHFHGLITTLFGYCCIGLTLVVLHFFSRVFRL
RRVCWFIGLCYIVVKVSLLSVLEIGVLPLICGWWLDICSLPLLDASLKDR
KESFKAAPGTSLFVHWMFGMVYVYYFAAFVSLLREVLRPGVLWIFRNVND
PDFSPIQEMIHVPIVRHIRRLVASAMIFGFAVLLMLWLPIRILQVVCPDF
LPYALSGDSAVNLQLLLLQIVLPGFFEQTQTRIWLKGLLRIWCTAVAWLL
GIRSYLLPAPEPEPEIPAAGEEGVENAAGENENQEGEAADAAAQPPAPPP
PPPPPVEPAPAPRNLAAAHQAIMQRDAPVGFQPYDKPSLFALRLCALLAL
MCLSIVCAAMLTLTVPVYIGRRLMLIWSSQPDEKAAGAAAAEGAGEVVEN
LDPIDPEGARKNERLLRSHELYTAELGGYLCWIVCRVVAAVVTLLPQGRA
AIVDKIKHWVRVALQYALPVLTLLGIFVLVPLLIGLLIELAVVIPLRVPL
RKTPIHFLWEDWALGVLYCKIAIALTMMGPDWHLKRALDRAYMDGLRDFD
LKFVMRDLAVPVVTTIGLALAIPYVMAHMMFPIFLADAYAQHVVARLVYP
VSFIVVGSICILLFQIDQLKKLYLSIKVDKYLVGQRLVNYEHRKKQQQQQ
EEEKEQQRAARELRENQERDREREREQLVQELELAELL*

FI03626.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24869-PA 1010 GF24869-PA 1..951 1..945 3799 86.1 Plus
Dana\GF23737-PA 608 GF23737-PA 38..93 5..60 191 51.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14521-PA 990 GG14521-PA 1..990 1..988 3974 90.9 Plus
Dere\GG14045-PA 620 GG14045-PA 38..93 5..60 191 51.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15006-PA 1016 GH15006-PA 1..981 1..970 3698 76.8 Plus
Dgri\GH16861-PA 674 GH16861-PA 41..96 5..60 180 50 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG1317-PD 988 CG1317-PD 1..988 1..988 5212 100 Plus
CG1317-PC 988 CG1317-PC 1..988 1..988 5212 100 Plus
CG1317-PB 988 CG1317-PB 1..988 1..988 5212 100 Plus
CG4080-PB 617 CG4080-PB 38..93 5..60 194 51.8 Plus
CG4080-PA 617 CG4080-PA 38..93 5..60 194 51.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13168-PA 976 GI13168-PA 1..905 42..945 3445 79.6 Plus
Dmoj\GI13084-PA 636 GI13084-PA 41..96 5..60 190 51.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24616-PA 920 GL24616-PA 136..882 208..987 2485 70.5 Plus
Dper\GL24616-PA 920 GL24616-PA 1..99 1..99 522 91.9 Plus
Dper\GL22630-PA 614 GL22630-PA 39..94 5..60 192 51.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12095-PA 1048 GA12095-PA 1..1010 1..987 3634 77.4 Plus
Dpse\GA17942-PA 614 GA17942-PA 39..94 5..60 193 51.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14125-PA 986 GM14125-PA 1..986 1..988 4169 95.5 Plus
Dsec\GM24879-PA 621 GM24879-PA 38..93 5..60 192 51.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13395-PA 984 GD13395-PA 1..984 1..988 4256 95.1 Plus
Dsim\GD12929-PA 206 GD12929-PA 38..93 5..60 199 51.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11944-PA 1027 GJ11944-PA 1..976 1..967 3626 75.6 Plus
Dvir\GJ13833-PA 634 GJ13833-PA 41..96 5..60 191 51.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12516-PA 1092 GK12516-PA 1..1017 1..957 3493 75 Plus
Dwil\GK17579-PA 628 GK17579-PA 39..94 5..60 192 51.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21712-PA 998 GE21712-PA 1..998 1..988 3948 92.7 Plus
Dyak\GE21248-PA 620 GE21248-PA 38..93 5..60 191 51.8 Plus

FI03626.hyp Sequence

Translation from 257 to 3223

> FI03626.hyp
MDDLSQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHK
EYCELCSYSFSFQPIYAPDMPRVLPIKDVLVGLMSAVLEGARCWLHYTLV
GLAWFGVVPLSAYRTYRYLFRASSFDMILTLPFDIFSVENLASDAFRGCF
VVTCTLLSFIGLVWLREQILHGGGPDWLERDDAPLQAAAANPAPDPAAEA
APQPQDDNNNADDNEAPAPADNDGQDAQAQDAAPAAAAPVVDADADEQNW
NPMEWDRAAEELTWERLLGLDGSLVFLEHVFWIISLNTMFIFTFAFCPYC
VGNFILSSMDLLQPEKPLLHFHGLITTLFGYCCIGLTLVVLHFFSRVFRL
RRVCWFIGLCYIVVKVSLLSVLEIGVLPLICGWWLDICSLPLLDASLKDR
KESFKAAPGTSLFVHWMFGMVYVYYFAAFVSLLREVLRPGVLWIFRNVND
PDFSPIQEMIHVPIVRHIRRLVASAMIFGFAVLLMLWLPIRILQVVCPDF
LPYALSGDSAVNLQLLLLQIVLPGFFEQTQTRIWLKGLLRIWCTAVAWLL
GIRSYLLPAPEPEPEIPAAGEEGVENAAGENENQEGEAADAAAQPPAPPP
PPPPPVEPAPAPRNLAAAHQAIMQRDAPVGFQPYDKPSLFALRLCALLAL
MCLSIVCAAMLTLTVPVYIGRRLMLIWSSQPDEKAAGAAAAEGAGEVVEN
LDPIDPEGARKNERLLRSHELYTAELGGYLCWIVCRVVAAVVTLLPQGRA
AIVDKIKHWVRVALQYALPVLTLLGIFVLVPLLIGLLIELAVVIPLRVPL
RKTPIHFLWEDWALGVLYCKIAIALTMMGPDWHLKRALDRAYMDGLRDFD
LKFVMRDLAVPVVTTIGLALAIPYVMAHMMFPIFLADAYAQHVVARLVYP
VSFIVVGSICILLFQIDQLKKLYLSIKVDKYLVGQRLVNYEHRKKQQQQQ
EEEKEQQRAARELRENQERDREREREQLVQELELAELL*

FI03626.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG1317-PD 988 CG1317-PD 1..988 1..988 5212 100 Plus
CG1317-PC 988 CG1317-PC 1..988 1..988 5212 100 Plus
CG1317-PB 988 CG1317-PB 1..988 1..988 5212 100 Plus
CG4080-PB 617 CG4080-PB 38..93 5..60 194 51.8 Plus
CG4080-PA 617 CG4080-PA 38..93 5..60 194 51.8 Plus