Clone FI03639 Report

Search the DGRC for FI03639

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:39
Vector:pOT2
Associated Gene/TranscriptPif1B-RA
Protein status:FI03639.pep: gold
Sequenced Size:3788

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Pif1B 2008-12-18 5.12 accounting
Pif1A 2008-12-18 5.12 accounting

Clone Sequence Records

FI03639.complete Sequence

3788 bp assembled on 2008-09-08

GenBank Submission: BT044150.1

> FI03639.complete
GAGCGGGCGCGCTGCCTGGAGGACGAGCTGCGAACCAAGGACGAACAATG
CCAGCTCTTGGAACGCAAACTGGGCGTTATGCCCGAGGGCTACAGCCTGG
CCGATGAACTCCATGATAGTCCTGCGAAGCGGGCCAAGAAGGATGAGGTA
CCGAGCCTCCAGGCTGCCAGCCAGGGACTGGGCGTGGCCCTACTCGATCT
CGAGGGTCGTGATTTTGGTCTACCACTGCACAAGGACTTCCAAGCAATTG
CCTGCAGTGTAAAGCAACTGGCGGATACCCTTCTCTCACAGAGTCCGTCC
GAGAATGCCCGGCTCTGATGTACATGCAGCATGAGCGACATTCCGACAGC
GACCCCAACTCCCGCCATCAACAAACCGAGGCATCCCACATGAGAGACCA
CTGGAAGCCGTCAAAATCCCAACAGTCGCAACAATCTGATCGTGTAGACC
CTCATGACAAGCCATCGCAGACGGCGGTCTCCTTTCTGCAGAAACACCAC
ACGCCTAAGAACCCGGAATCGAAGGCTAATCCAGATGATGGGGCGTCCTG
CTCATGCACCGCAAAGAGGTCCAAGTCCGCCGATCCACCAGCGGTTAAAG
CTCACACCTGTGCATGCAACACCGATCCAAGTCCATGTGGACTGGGTCAT
CAGGAGAAATCCAGTTCGAGGAAGCCCTGCTCCCAGAAAACATCGGTTAC
GGAACCAGAGAAGGCTTCCTCATTCAAGAGTGCTATAACAGCGTGTACCA
AGGAGCTCCTCGATCCCTGCACTTGTGGCGCCCACCCACCATACTGGGCT
GGTCAAAGCAACTTGGTAACCGGACCATCCTACAGTAGAGCAATGGACCC
CTCCTCAAGCACTCTCGCTCCCTTGCATAGACCCGGAGCATCAAAAGGCA
GCTTTGGTCGATCCAAGAGTTTGGCCAGTCTGCCTAGTAAATCTAATCCG
CCAACTCAGAGTGGCGTCACTTGGTTGTCGGCTTTAAAGGATCCGGAGAG
TACATGTTGCTCTTCCAAAGAGGACGAACGTCCTGCATGTACCTGCAACG
CTACCCAGACTAATCAGGATCCTTCTATGAGTTCACTTCCTCAGAGCCAT
CCCAATTATCGCAGTATGACATCCAAATCAAGTAATTTCAGGGCGCCAAA
CCCGCGCAATCAACCCTCCTTTGGGCCAGGCGATGAGACCTCAGCAACCA
CACGATCCCAATCGATTGTGGGTCAGGTCACCTGCCTATGCGCATCGGAG
CATCAACCCACCAAGGCCTTTGTGTCGAGCCTGGCCGATCGGGAATGCCC
AAATGAGATCCAGATTGCGCCATGCCCCTCCACAAGAATACACCATCCAT
CCGGGTTTGCCCAGTTCACCGATTGTCAGAACTCTCAAGGCGACCCCAGT
ACCTCTTTCCGTTCTAGGAAAGTGAGCGTTAAGGGTCAGGAGGAATTTTG
TGACTGTGATGCTTCTGATAACTTCTCCGAACTGTCCGATCCCATCCAGA
CCAGTCTTCATACGCACAGGAGTCTTTCCGGGGGTAGTTGCCTGTGCAAC
GACGATGCAGATCCTCCGAAGGAACCCGAAAAGGCTACGTGTGTCAGCAA
GCAGTGCCAGTGCTCTTCGAATGACGAGCTTCAGGGGATGCAAAGTGCCC
AAGCGGGTACCGGCTATCAGACACCAGAGGATCTTTGTGGAAATAGGGCT
ATGGCCTGCTGTTCTCGTAAGGAACGCATCCTGATGCTGATGGAGAAACT
GACCAGTCCTGGTTGCGATTGCGGTATATCTCGCCCCTGCCTGACCCAAC
AACTTTTCCGGGAACTAACACTACTCCTGAGATCAGAAAAAGATGATGCA
GTTGCACCAGCGGATGAAGCTAGCCCACCGTGCCTAACCTTCGATGAGTG
CTGTACGGCCCAACATGCTGGCAATGGGGAAGGCGATCCAGTCGAAAAAC
CCCCGTCAAAGAGAGAGCTCCAACGAGTCGAGTGCTTTCATCAACTGGAG
GAATACCTCTGCAAGTGCTTCCTGCCGCCGGCAGAACCTCAGATTCCTGA
GACCGATATCTATGCTTTTGAACTAGATCCGGACTTTCCACCAGAACCTG
AGCCAAAATCTCCCAAGGAAAATGACAACATGCAACCTTGTCAGTGCCCG
GAACAATTCTTTGACATTGGAAATGCACTAACCTGTTCGGGTGATGGCTT
GGATGATGACTTCTTTCGTGATTGTGAGGATGACGAGGAAGTAAAAAAGT
TCGAAAGTAAGGATGATGGTAAAGCAACCACGGAGCCGGATCTCTGCCAA
TCTCTTAAAGCATTCATCGACAAGGAACTGCAAGAAATTCTTGCGGAGGA
GGCCAATAAGGAAGGCGAGGAGGTAGAAGAAAAAACTCCTAGCACAGTAC
TAAGGGAAATCTGTGAGAGACCCACAACCGTGGCGTCACCGGAAGAAGAG
GAGAAACCAGAACAGATTGAGTGTCCATTTGCTGGCATGGTGTCCTGTCC
TCCTTGGACCACACAGCAAACAGACTGGGCAGCCTTCCCCTACAACTTAG
ATCCCTGTGCGCAAAAGGAGTCACCTAGCCCGGCGCCCCGGGGTCCACGT
ACTGGGCTATTGCCCGAAGGACCTCTGTCACCCGATATGAGGAACCTCTG
CGAGCAGCTTTTGCGAAAAGCTCTTAAGGATTGTGGTCTGTGTGGTGGTG
ACGATGTGTACTCCTGCGAGGACGATGTATGCGAAGAGTGCGCGCTGAAT
TGTGAGGAATGCCCGGAAGATTGCCCGTTGGAAAAGTGCGAGGAATGCGA
TGATGAGTGTCCCCCAGAACAACAAGGATGCCTATGCTGCCACTGTCGCG
CTCTCATATGCGACGAGGAGTGCAAGACGGTTGCCAATACCCTGCGCTCC
GGAATGTGTGATCCACTCTGCGAAATGAAATACTTTATAGACTCCATCAT
CGTTGATATGCATGCCATGGATTGTGTGCTCGGCAACAAGAAAGCGAAAC
CAAAGCACCTTAAGGCTACAGACTTGACCAACAGAGGTGGACCCGGCGAT
AGTTTTCCCGTCAAAATTAAGAGTGTGTGGCCATTGGGTAACACCGCTCT
CTACGTCCAATGGCAATTGGAGGACTGTCGCGCTGTAGCAGGATATGAGA
TTTACTTGGATGGGCATTTGACGAACCGATTTTACAGTTTTCGTCACGAG
GCCGGAGTTATTACCAATGCGGATGTGACCAATCCGCACCAGGTTGTGGT
GCGCGCCGTAGCGGTGGGTCAGGAGTTTCCCGGCGAGGGTCCGGGTAAGG
ATGCGACCCAGGAATGTGGCTGCCAGGCGGTGGCACTTGCTCATCCCGAA
TTGAAGGCGGGAGCACAGAGGCCGTGGTCGCCCAGTCTCTACTATTATGA
TCCCAACCAATTGCCGCCGGCGGAGGACGTGCAGCCGTGCTAGTCATGAA
TCATATGTATATCATTATATCGAATATCGTCGGATATCACCGTTATCGGA
ACAAAGGAGCTAAACGCTCCCTCACTTTTTAGCTTGTACATATAGCGTAT
TGATATGTAGTGTTTGTTAAGAGTTCTTTATCTGGAGGATACCAATTGAA
ATCGTCTGTACGTAGTGCTTTGCATAGTGCCTTAAATCGTAATAGTATAT
CGTAAGCAAATATCAATGCATTGTAATGGAATTGAAAGCAGGTGGCTTCA
TTCCGATGGCACGTTTGAGTTCACCAACACCAAATTCACTTTAAATAAAT
GAATCTCATTGTTAGAGATGAAAAAAAAAAAAAAAAAA

FI03639.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Pif1B-RA 6324 Pif1B-RA 2555..6324 1..3770 18850 100 Plus
Pif1A-RA 6324 Pif1A-RA 2555..6324 1..3770 18850 100 Plus
Pif1B-RB 4148 Pif1B-RB 680..4148 302..3770 17345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4601291..4603916 2927..302 13100 99.9 Minus
chr3R 27901430 chr3R 4600259..4600881 3770..3148 3085 99.7 Minus
chr3R 27901430 chr3R 4608414..4608618 205..1 1025 100 Minus
chr3R 27901430 chr3R 4600944..4601093 3149..3000 735 99.3 Minus
chr3R 27901430 chr3R 4608259..4608359 303..203 505 100 Minus
chr3R 27901430 chr3R 4601156..4601234 3005..2927 395 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
Pif1B-RD 3126 CG33720-PD 1..3126 318..3443 15630 100 Plus
Pif1B-RC 3126 CG33720-PC 1..3126 318..3443 15630 100 Plus
Pif1B-RB 3126 CG33720-PB 1..3126 318..3443 15630 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:48 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Pif1A-RA 6324 CG42599-RA 2555..6324 1..3770 18850 100 Plus
Pif1A-RH 7694 CG42599-RH 3925..7694 1..3770 18850 100 Plus
Pif1A-RG 7761 CG42599-RG 3992..7761 1..3770 18850 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
Pif1B-PD 1041 CG33720-PD 1..1041 318..3440 5100 100 Plus
Pif1B-PC 1041 CG33720-PC 1..1041 318..3440 5100 100 Plus
Pif1B-PB 1041 CG33720-PB 1..1041 318..3440 5100 100 Plus
Pif1B-PA 1041 CG33720-PA 1..1041 318..3440 5100 100 Plus
Pif1A-PA 879 CG33719-PA 775..879 1..315 531 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8775318..8777943 2927..302 13130 100 Minus
3R 32079331 3R 8774272..8774908 3784..3148 3170 99.8 Minus
3R 32079331 3R 8782441..8782645 205..1 1025 100 Minus
3R 32079331 3R 8774971..8775120 3149..3000 735 99.3 Minus
3R 32079331 3R 8782286..8782386 303..203 505 100 Minus
3R 32079331 3R 8775183..8775261 3005..2927 395 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8516149..8518774 2927..302 13130 100 Minus
3R 31820162 3R 8515103..8515739 3784..3148 3170 99.8 Minus
3R 31820162 3R 8523272..8523476 205..1 1025 100 Minus
3R 31820162 3R 8515802..8515951 3149..3000 735 99.3 Minus
3R 31820162 3R 8523117..8523217 303..203 505 100 Minus
3R 31820162 3R 8516014..8516092 3005..2927 395 100 Minus
Blast to na_te.dros performed on 2014-11-27 05:17:04 has no hits.

FI03639.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:29:34 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4608415..4608618 1..204 100   Minus
chr3R 4608259..4608357 205..303 100 <- Minus
chr3R 4601291..4603914 304..2927 99 <- Minus
chr3R 4601156..4601233 2928..3005 100 <- Minus
chr3R 4600944..4601087 3006..3149 100 <- Minus
chr3R 4600259..4600879 3150..3770 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:44:52 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1B-RB 1..3126 318..3443 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:00:23 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1B-RB 1..3126 318..3443 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:21:56 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1B-RB 1..3126 318..3443 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:01 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1B-RB 1..3126 318..3443 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:29:34 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1B-RB 1..3126 318..3443 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:17:44 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1B-RA 2555..6324 1..3770 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:00:22 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1B-RA 2555..6324 1..3770 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:21:56 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1A-RG 3992..7761 1..3770 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-08 11:36:34 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1B-RA 2555..6324 1..3770 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:29:34 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
Pif1A-RG 3992..7761 1..3770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:29:34 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8782442..8782645 1..204 100   Minus
3R 8782286..8782384 205..303 100 <- Minus
3R 8775318..8777941 304..2927 100 <- Minus
3R 8775183..8775260 2928..3005 100 <- Minus
3R 8774971..8775114 3006..3149 100 <- Minus
3R 8774286..8774906 3150..3770 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:21:56 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4608164..4608367 1..204 100   Minus
arm_3R 4608008..4608106 205..303 100 <- Minus
arm_3R 4601040..4603663 304..2927 100 <- Minus
arm_3R 4600905..4600982 2928..3005 100 <- Minus
arm_3R 4600693..4600836 3006..3149 100 <- Minus
arm_3R 4600008..4600628 3150..3770 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:27:22 Download gff for FI03639.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8523273..8523476 1..204 100   Minus
3R 8523117..8523215 205..303 100 <- Minus
3R 8516149..8518772 304..2927 100 <- Minus
3R 8516014..8516091 2928..3005 100 <- Minus
3R 8515802..8515945 3006..3149 100 <- Minus
3R 8515117..8515737 3150..3770 100 <- Minus

FI03639.pep Sequence

Translation from 317 to 3442

> FI03639.pep
MYMQHERHSDSDPNSRHQQTEASHMRDHWKPSKSQQSQQSDRVDPHDKPS
QTAVSFLQKHHTPKNPESKANPDDGASCSCTAKRSKSADPPAVKAHTCAC
NTDPSPCGLGHQEKSSSRKPCSQKTSVTEPEKASSFKSAITACTKELLDP
CTCGAHPPYWAGQSNLVTGPSYSRAMDPSSSTLAPLHRPGASKGSFGRSK
SLASLPSKSNPPTQSGVTWLSALKDPESTCCSSKEDERPACTCNATQTNQ
DPSMSSLPQSHPNYRSMTSKSSNFRAPNPRNQPSFGPGDETSATTRSQSI
VGQVTCLCASEHQPTKAFVSSLADRECPNEIQIAPCPSTRIHHPSGFAQF
TDCQNSQGDPSTSFRSRKVSVKGQEEFCDCDASDNFSELSDPIQTSLHTH
RSLSGGSCLCNDDADPPKEPEKATCVSKQCQCSSNDELQGMQSAQAGTGY
QTPEDLCGNRAMACCSRKERILMLMEKLTSPGCDCGISRPCLTQQLFREL
TLLLRSEKDDAVAPADEASPPCLTFDECCTAQHAGNGEGDPVEKPPSKRE
LQRVECFHQLEEYLCKCFLPPAEPQIPETDIYAFELDPDFPPEPEPKSPK
ENDNMQPCQCPEQFFDIGNALTCSGDGLDDDFFRDCEDDEEVKKFESKDD
GKATTEPDLCQSLKAFIDKELQEILAEEANKEGEEVEEKTPSTVLREICE
RPTTVASPEEEEKPEQIECPFAGMVSCPPWTTQQTDWAAFPYNLDPCAQK
ESPSPAPRGPRTGLLPEGPLSPDMRNLCEQLLRKALKDCGLCGGDDVYSC
EDDVCEECALNCEECPEDCPLEKCEECDDECPPEQQGCLCCHCRALICDE
ECKTVANTLRSGMCDPLCEMKYFIDSIIVDMHAMDCVLGNKKAKPKHLKA
TDLTNRGGPGDSFPVKIKSVWPLGNTALYVQWQLEDCRAVAGYEIYLDGH
LTNRFYSFRHEAGVITNADVTNPHQVVVRAVAVGQEFPGEGPGKDATQEC
GCQAVALAHPELKAGAQRPWSPSLYYYDPNQLPPAEDVQPC*

FI03639.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 20:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16834-PA 1148 GF16834-PA 1..1148 1..1041 1875 40.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 20:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17422-PA 1042 GG17422-PA 1..1042 1..1039 4231 80.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 20:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19338-PA 1544 GH19338-PA 1316..1544 768..1029 655 50.4 Plus
Dgri\GH19338-PA 1544 GH19338-PA 949..1116 448..623 221 36.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Pif1B-PD 1041 CG33720-PD 1..1041 1..1041 5740 100 Plus
Pif1B-PC 1041 CG33720-PC 1..1041 1..1041 5740 100 Plus
Pif1B-PB 1041 CG33720-PB 1..1041 1..1041 5740 100 Plus
Pif1B-PA 1041 CG33720-PA 1..1041 1..1041 5740 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 20:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23949-PA 278 GI23949-PA 53..278 769..1029 594 46.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 20:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12129-PA 1567 GL12129-PA 1046..1552 466..1030 887 39.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 20:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26199-PB 1543 GA26199-PB 927..1050 466..589 265 45.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 20:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26313-PA 936 GM26313-PA 1..931 1..938 4347 92.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 20:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20844-PA 1035 GD20844-PA 1..1035 1..1041 4860 90.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 20:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23737-PA 2103 GJ23737-PA 1878..2103 769..1029 628 48.7 Plus
Dvir\GJ23737-PA 2103 GJ23737-PA 1432..1552 468..596 202 41.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 20:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11262-PA 456 GK11262-PA 216..456 762..1030 620 50 Plus
Dwil\GK11262-PA 456 GK11262-PA 1..123 474..597 222 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 20:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24824-PA 1024 GE24824-PA 1..1024 1..1039 4081 79 Plus

FI03639.hyp Sequence

Translation from 317 to 3442

> FI03639.hyp
MYMQHERHSDSDPNSRHQQTEASHMRDHWKPSKSQQSQQSDRVDPHDKPS
QTAVSFLQKHHTPKNPESKANPDDGASCSCTAKRSKSADPPAVKAHTCAC
NTDPSPCGLGHQEKSSSRKPCSQKTSVTEPEKASSFKSAITACTKELLDP
CTCGAHPPYWAGQSNLVTGPSYSRAMDPSSSTLAPLHRPGASKGSFGRSK
SLASLPSKSNPPTQSGVTWLSALKDPESTCCSSKEDERPACTCNATQTNQ
DPSMSSLPQSHPNYRSMTSKSSNFRAPNPRNQPSFGPGDETSATTRSQSI
VGQVTCLCASEHQPTKAFVSSLADRECPNEIQIAPCPSTRIHHPSGFAQF
TDCQNSQGDPSTSFRSRKVSVKGQEEFCDCDASDNFSELSDPIQTSLHTH
RSLSGGSCLCNDDADPPKEPEKATCVSKQCQCSSNDELQGMQSAQAGTGY
QTPEDLCGNRAMACCSRKERILMLMEKLTSPGCDCGISRPCLTQQLFREL
TLLLRSEKDDAVAPADEASPPCLTFDECCTAQHAGNGEGDPVEKPPSKRE
LQRVECFHQLEEYLCKCFLPPAEPQIPETDIYAFELDPDFPPEPEPKSPK
ENDNMQPCQCPEQFFDIGNALTCSGDGLDDDFFRDCEDDEEVKKFESKDD
GKATTEPDLCQSLKAFIDKELQEILAEEANKEGEEVEEKTPSTVLREICE
RPTTVASPEEEEKPEQIECPFAGMVSCPPWTTQQTDWAAFPYNLDPCAQK
ESPSPAPRGPRTGLLPEGPLSPDMRNLCEQLLRKALKDCGLCGGDDVYSC
EDDVCEECALNCEECPEDCPLEKCEECDDECPPEQQGCLCCHCRALICDE
ECKTVANTLRSGMCDPLCEMKYFIDSIIVDMHAMDCVLGNKKAKPKHLKA
TDLTNRGGPGDSFPVKIKSVWPLGNTALYVQWQLEDCRAVAGYEIYLDGH
LTNRFYSFRHEAGVITNADVTNPHQVVVRAVAVGQEFPGEGPGKDATQEC
GCQAVALAHPELKAGAQRPWSPSLYYYDPNQLPPAEDVQPC*

FI03639.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
Pif1B-PD 1041 CG33720-PD 1..1041 1..1041 5740 100 Plus
Pif1B-PC 1041 CG33720-PC 1..1041 1..1041 5740 100 Plus
Pif1B-PB 1041 CG33720-PB 1..1041 1..1041 5740 100 Plus
Pif1B-PA 1041 CG33720-PA 1..1041 1..1041 5740 100 Plus