Clone FI03642 Report

Search the DGRC for FI03642

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:42
Vector:pOT2
Associated Gene/TranscriptDref-RA
Protein status:FI03642.pep: gold
Sequenced Size:2744

Clone Sequence Records

FI03642.complete Sequence

2744 bp assembled on 2009-09-04

GenBank Submission: BT099709.1

> FI03642.complete
AATACTCAACAAATCGCATTTTTTACGACAGTCAGACGTATTGAAATTAA
AAAGCGGTGACTCTCATATTTGAGCAGTCTGTAAAAATAATCTCAAATAA
ATGAGAGTGCATTTGAAGCATTTAGCAACGTTTTATTGCCTTATCGATTG
ACGGCGTGTCGCGTGGCAACTCTGAACTGTACTTCTGATACAGATAAAAA
ACTATTGACTATTGAACCGTCTATCTATAATCGAGAAATTGCGCGCTAAT
ACACGCATTGGGCACAGCAATCGTTGTCGAATCTAATTCAAAACAAACAA
GAAGATCCCAATCCCCCACAGAAGACAAGATGAGCGAAGGGGTACCAGCG
TCGCCCGTGGCCATTGGCGAACTCAAGTACGAGGATGTGTCGCAGCTAAA
TTTTTCCAAACTGTACTCGCCCAAGATGAAAAGCGTATACTGGCGCTACT
TTGGATTCCCCTCGAACGACAATAATGAGGTGATTACCAAACAGAATGTG
GTCTGCATTAAGTGTCACAAGGTGCTGACCAACCATGGCAACACCACCAA
TTTGCGTGCGCATCTCCAGCACCGACACAAGGATCTGTTCAAGGAGCTGT
GCCAGGAGCACGACATCCATGTGCCGCCGCGCAAGACGCCGCGTAATGTA
TCCCATCCACCGCTGTCCAAGCGGAATGTTTCCTCGCGGCGGGTCAAACT
GGAGTTCATTAATAACCGGAACCACGATAACGCTTCCGATGATGAACTGG
ACGAAGCAGCCGTGGCAACTGCGGCCATGCAGGCGGAGGAGGACGCCTCC
TCGCAAACCATGCTGTACGAGACCATGGTGCCCTTCACCTACGACGAGGC
CGAAAATCTGGTAGAGGAGGAGGAGCGCCTAGTTATGGAACCAAAGTACG
GACGCAAACGCAAAGTGGCCACTCCATCGAGTGCCCTGATGCACGGGCGT
GTCATCAAGCACGAGGAAGGCGGCTATGCCGCCGTGGCGAACATCGCCAA
TCTGGCCGAAGCCCTTACGGACATTGTGATTAAGGATTTGCGCAATGTGG
ATTCTCTGTACGATGCCGGTTTTGGTGAATTCCTGCGTCAAGTCCTAGGC
AATTCGGCAGCCATGCCCGAGCCACACAAGATCGACTCTTTGATCAATGA
GATGCACGCCTCCAAGTTTCTGGAGATTGGCGAAATCACGCGCGATTTCA
CCTCCGAGAAGCCCTTCTCTCTCGCCTTTGAGATGTGGGTGAATGTTGAA
CAGCGGCGCTTCCTTAGCATCTTCCATCACTTTCTGGACGAGGAGACGCA
CTCAGTTCGCGGTATGCTGTATGCCACCGTGGAGTACAACGACTACATCG
TCTTTGACGATCTGCTGACCGACTTCTATTTGGCCAATTGCACACTGGCC
ATCATAAACTACGACGAGGAAGAGGACCTTTTGCACACCTATCTGCGAGA
GAAAAATATACCCATTTCGCTGTGCTACGTTTCGGTAATTGACAAATGTT
TGCGTCGTGTGTTTGAGATCGAAGAGGTGGCCACTTTATTGGAGCAGGTG
AAGGACCTAATGCAGCGTCATTCAACGGAGATTGCCTCCAAGGTGTCCGA
GGTGCCCATGCCCACGTACAACGAGCACTTCCCCTGGACACTGTACGAAA
CATTGAAGTTCTTTGCCGAGTCCATATCTTGGTCCGAGGACATGGATCAC
CTGGTTATATCAGCCAAGACGGTGACGGAGGCCCTGAGTGCTCTGGTGAT
TGCTTTGGACACGCTGCGTGGCGAAGACATTCCCTTGTGTAGCATGCTTT
CGCCAATCACTTCAAAGATTCTTATCAAGAAGTTGGGCATCGCCGAGCAG
GACGATCCCCTAATGATGAATTTGAAGCGGACCATTTCCAGTGTCCTCCA
GGCGCACGTTATATCCAATGACAATCTGACCGCTGCTGCATTGTTGGACC
CACGCTTCCACCGCCTGACCACCATTGACAACCTAGAGCGAACCGTTCGT
ATGCTGACCCATAAGTATAACATTAACTTTGGTGGAGTGGGCGAAGGGGA
ATCCAACGAAGTGGCAGCTACCTCCAGCGTGGTGGCCATTAAGTCAGAAC
CAAGAGTAGTGGACGGCAGTGCACCAAAGAAGTTGGGTCTGAAACTGCTG
TTTGACAGTAACGAGATACCAAATCCTCCGAAGCGAGATGCGGACAGCAG
CGTGGAGTCCGATCTTAAGCGATATCGCAACGAGGTGGTCGTTCAGCTGG
ATGAGTCGCCCATCGAGTGGTGGCTCAAGATGGGACACATTTATGGAACG
CTCCGCGATTTGGCCAGCCTGTACCATAGTGTGCCCGGCGTGGTGACGCT
CAGCTTCAAGAAGGCGCTGAGAGACCAAATATACGACTTCAACAAGCGAT
TCATGCTCACCGGTAGTCACATCGACGCCATCCTCTTTCTTCATCATCAC
AACAATTAGTCTGCACTGGCGACTACTGTTTCTTATAATGCAAATACTTT
TTAATTACTTTTAACGTAATCCGATCTTGTGTATATGAAAATGACTACCA
GGGGCGAGGCAAATAGTAATAGCGATTCCGCAGTACTTTTAACCAAAAGA
CAGCCTTGGGACGTACACGGAACATCTTAAGTTATCGACGTATAAATGTT
AAGGGAACATTTTGACATCATATATTCAAATCAAACAGATAATCTAAGAA
TATTTGTTTAATAAATCCATAACGAAAAAAAAAAAAAAAAAAAA

FI03642.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dref-RA 3098 Dref-RA 242..2971 1..2730 13650 100 Plus
Dref.a 3095 Dref.a 242..2968 1..2730 13580 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9964689..9966143 1455..1 7260 99.9 Minus
chr2L 23010047 chr2L 9963209..9963797 2724..2136 2885 99.3 Minus
chr2L 23010047 chr2L 9963855..9964245 2138..1748 1955 100 Minus
chr2L 23010047 chr2L 9964305..9964597 1748..1456 1465 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dref-RB 2130 CG5838-PB 1..2130 330..2459 10650 100 Plus
Dref-RA 2130 CG5838-PA 1..2130 330..2459 10650 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:50 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dref-RB 2739 CG5838-RB 16..2739 1..2724 13620 100 Plus
Dref-RA 2872 CG5838-RA 16..2739 1..2724 13620 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dref-PB 709 CG5838-PB 1..709 330..2456 3429 100 Plus
Dref-PA 709 CG5838-PA 1..709 330..2456 3429 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9965760..9967214 1455..1 7275 100 Minus
2L 23513712 2L 9964274..9964868 2730..2136 2975 100 Minus
2L 23513712 2L 9964926..9965316 2138..1748 1955 100 Minus
2L 23513712 2L 9965376..9965668 1748..1456 1465 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9965760..9967214 1455..1 7275 100 Minus
2L 23513712 2L 9964274..9964868 2730..2136 2975 100 Minus
2L 23513712 2L 9964926..9965316 2138..1748 1955 100 Minus
2L 23513712 2L 9965376..9965668 1748..1456 1465 100 Minus
Blast to na_te.dros performed on 2014-11-26 23:15:55 has no hits.

FI03642.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:26:48 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9964689..9966143 1..1455 99   Minus
chr2L 9964305..9964597 1456..1748 100 <- Minus
chr2L 9963857..9964244 1749..2136 100 <- Minus
chr2L 9963209..9963796 2137..2724 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:49:49 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
Dref-RA 1..2130 330..2459 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:09:38 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
Dref-RA 1..2130 330..2459 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:44 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
Dref-RA 1..2130 330..2459 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:26:48 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
Dref-RA 1..2130 330..2459 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-04 10:41:08 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
Dref-RA 242..2965 1..2724 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:09:37 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
Dref-RA 242..2965 1..2724 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:44 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
Dref-RA 16..2739 1..2724 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:26:48 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
Dref-RA 16..2739 1..2724 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:26:48 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9965760..9967214 1..1455 100   Minus
2L 9965376..9965668 1456..1748 100 <- Minus
2L 9964928..9965315 1749..2136 100 <- Minus
2L 9964280..9964867 2137..2724 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:44 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9965760..9967214 1..1455 100   Minus
arm_2L 9965376..9965668 1456..1748 100 <- Minus
arm_2L 9964928..9965315 1749..2136 100 <- Minus
arm_2L 9964280..9964867 2137..2724 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:01:24 Download gff for FI03642.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9965760..9967214 1..1455 100   Minus
2L 9965376..9965668 1456..1748 100 <- Minus
2L 9964928..9965315 1749..2136 100 <- Minus
2L 9964280..9964867 2137..2724 100 <- Minus

FI03642.pep Sequence

Translation from 329 to 2458

> FI03642.pep
MSEGVPASPVAIGELKYEDVSQLNFSKLYSPKMKSVYWRYFGFPSNDNNE
VITKQNVVCIKCHKVLTNHGNTTNLRAHLQHRHKDLFKELCQEHDIHVPP
RKTPRNVSHPPLSKRNVSSRRVKLEFINNRNHDNASDDELDEAAVATAAM
QAEEDASSQTMLYETMVPFTYDEAENLVEEEERLVMEPKYGRKRKVATPS
SALMHGRVIKHEEGGYAAVANIANLAEALTDIVIKDLRNVDSLYDAGFGE
FLRQVLGNSAAMPEPHKIDSLINEMHASKFLEIGEITRDFTSEKPFSLAF
EMWVNVEQRRFLSIFHHFLDEETHSVRGMLYATVEYNDYIVFDDLLTDFY
LANCTLAIINYDEEEDLLHTYLREKNIPISLCYVSVIDKCLRRVFEIEEV
ATLLEQVKDLMQRHSTEIASKVSEVPMPTYNEHFPWTLYETLKFFAESIS
WSEDMDHLVISAKTVTEALSALVIALDTLRGEDIPLCSMLSPITSKILIK
KLGIAEQDDPLMMNLKRTISSVLQAHVISNDNLTAAALLDPRFHRLTTID
NLERTVRMLTHKYNINFGGVGEGESNEVAATSSVVAIKSEPRVVDGSAPK
KLGLKLLFDSNEIPNPPKRDADSSVESDLKRYRNEVVVQLDESPIEWWLK
MGHIYGTLRDLASLYHSVPGVVTLSFKKALRDQIYDFNKRFMLTGSHIDA
ILFLHHHNN*

FI03642.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Dref-PA 712 GF14143-PA 1..712 1..709 3077 82.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23986-PA 709 GG23986-PA 1..709 1..709 3524 95.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10661-PA 750 GH10661-PA 1..743 1..709 2719 71.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dref-PB 709 CG5838-PB 1..709 1..709 3668 100 Plus
Dref-PA 709 CG5838-PA 1..709 1..709 3668 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Dref-PA 743 GI10952-PA 1..732 1..705 2737 72.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19191-PA 694 GL19191-PA 1..694 1..709 2830 76.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Dref-PA 713 GA19169-PA 1..713 1..709 3030 79.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12069-PA 709 GM12069-PA 1..709 1..709 3573 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22316-PA 549 GD22316-PA 1..289 1..289 1388 97.9 Plus
Dsim\GD22316-PA 549 GD22316-PA 303..549 463..709 1276 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Dref-PA 742 GJ18300-PA 2..731 3..705 2734 73.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14535-PA 740 GK14535-PA 1..740 1..709 2742 73.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Dref-PA 709 GE10082-PA 1..709 1..709 3556 96.5 Plus

FI03642.hyp Sequence

Translation from 329 to 2458

> FI03642.hyp
MSEGVPASPVAIGELKYEDVSQLNFSKLYSPKMKSVYWRYFGFPSNDNNE
VITKQNVVCIKCHKVLTNHGNTTNLRAHLQHRHKDLFKELCQEHDIHVPP
RKTPRNVSHPPLSKRNVSSRRVKLEFINNRNHDNASDDELDEAAVATAAM
QAEEDASSQTMLYETMVPFTYDEAENLVEEEERLVMEPKYGRKRKVATPS
SALMHGRVIKHEEGGYAAVANIANLAEALTDIVIKDLRNVDSLYDAGFGE
FLRQVLGNSAAMPEPHKIDSLINEMHASKFLEIGEITRDFTSEKPFSLAF
EMWVNVEQRRFLSIFHHFLDEETHSVRGMLYATVEYNDYIVFDDLLTDFY
LANCTLAIINYDEEEDLLHTYLREKNIPISLCYVSVIDKCLRRVFEIEEV
ATLLEQVKDLMQRHSTEIASKVSEVPMPTYNEHFPWTLYETLKFFAESIS
WSEDMDHLVISAKTVTEALSALVIALDTLRGEDIPLCSMLSPITSKILIK
KLGIAEQDDPLMMNLKRTISSVLQAHVISNDNLTAAALLDPRFHRLTTID
NLERTVRMLTHKYNINFGGVGEGESNEVAATSSVVAIKSEPRVVDGSAPK
KLGLKLLFDSNEIPNPPKRDADSSVESDLKRYRNEVVVQLDESPIEWWLK
MGHIYGTLRDLASLYHSVPGVVTLSFKKALRDQIYDFNKRFMLTGSHIDA
ILFLHHHNN*

FI03642.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dref-PB 709 CG5838-PB 1..709 1..709 3668 100 Plus
Dref-PA 709 CG5838-PA 1..709 1..709 3668 100 Plus