Clone FI03655 Report

Search the DGRC for FI03655

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:55
Vector:pOT2
Associated Gene/TranscriptCG34408-RA
Protein status:FI03655.pep: gold
Sequenced Size:5243

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34408 2008-08-15 Release 5.9 accounting
CG34408 2008-12-18 5.12 accounting

Clone Sequence Records

FI03655.complete Sequence

5243 bp assembled on 2008-07-17

GenBank Submission: BT044152.1

> FI03655.complete
CTCGCTCGCTTTTCGCTGTGGATTTCTATTTTTTTTTTTTATTGTATTAA
ACAAATCGCAAAAATAGGTCTTTAATGGCGGTGTAATCGAATCGTAGTTG
TAAACAAAAACAAATAAAAGGGGCGGGAAGTGCGAGACAACATAAACATT
TGGGGAACTTCGCATTTTGCAACATGAGAGCGGTCAATTAGCAAGTCAAC
AACAACAACAACAACATGGCGCACCTGCACCTAAATTCTTCATGTTGACG
TCAACAAAGTGAAATCCGATCAAGAAATCGTAGCGATCGCAGAGAAGGGA
CCGCCATACGGATTATCGGGTGAATAGGAAGCATCGAGGAGGAGGAGGAT
TACCACGATCCCCAGGATCATCAGGAGCAGCAGAGTCCCCAGGATCCCTA
GAGTCCTTGGACTCCTCACCACACCAGGATGTACTCCGAGTGGGCCTCGC
TGTCTGCCCAAATCACAGCCAACAGCTGCGGCGCCCAGTGCTTCAGTGTG
CTCAACAAATTCCCCGCCTCCGCCGGACGCGAAGTGGTCGTCTCCGTGGT
CAAGCAGCTGGGCACCAATCTGGGCATCACGCAGAATGCAGAGCCCAGTC
ACCTGGTCAAAGACGAAGAGGTAAAATGGTGCATGGACGTGATCTGCTTC
GGACTTTCGCTTCCTCTGCAGGAACACGAGACGATCAAGGATTGCGTGAA
TGTGTACTGCGAGTGGCTGACGGCGCTGCATCCGCAGCCCAGGATCAGTG
TACCGAAGCCGATATGCGAGGATGCCAATCTCTATGCTCGCCAGATCATC
AATCACTTTCACAATCTGTTTGTGCCGCGCCAGGGCGAAAGTGCAGATAC
AATTAAACGGCAGGCAGTGCTCTGCCATCGGGTGCTACGAACTCTGCAGC
AAACTGCTCAGATATCGCAGCTAATGGATCGGCAGACGTGGGACACGCTG
CTTCTCTTTCTGCTGGCTATCAATGAGATCCTGCTGGCGCCGCCCACCGT
CAAGGACGATGTGGGCGATCAGCTGTGCGAGCGTGTGCTATCCGTGCTCT
TCGAGGTCTGGCTTCTGGCCTGCGTTCGCAGTTTTCCCTCACCGTCGATG
TGGAAGACGCTGCAGGAGTCGTGTGCCATGTGGCGACACCGTGTAGCCCT
CGTGGATCAATGGAATCGAGTGAACTTGGCACTAACCGCTCGCCTGCTGG
AGTTCAGCTATGGTCCTGCGTTTCCACAGCTCAAGAATGCCGACGAGGAT
GGCCAGCTGATACCAATTGGAATGTCCAACGACTGTGTGGCCCAGACTTG
GTACCGCTTCCTGCGTATGATTGGCAATCCCACGGCGCTCTGTTCACCAC
ATATCATCAGCAAATCATCACACTTTGTTCAGTGGGCGTTGACCCATGAA
AAGGGCGCCGAGACGCATCAGCATCCCTGCCTGCAACAACTGCCGCAGAT
CTTCCTCAATGCCATGAAGGGAATTTCCAGTCAAGTGGACGCTTTTCTAG
GCTTGAGCAAGACCTCGCTTATTGGCCTCACCGGCGGTGGTGCACGCAAC
GCGATCAGCAGCAGCAGCACCACCACCACCAATGCCGGCAGCACGGGAGG
AACGGGATCGGGAGATGGATCCGCTCCTGCTCCGCTGCCCACAACTCCCA
CGTCCACGTCGGGTCCGCCGTCGGCGAGTAGCAGCATCAACTCTCTGCCG
TTGACTTCGATGGGAGCGGGTGTCGAGCTGGCCGTGGCCAGACCCAAATG
CAACAGCATTCTCCACGTATTCCACGAGTGGCTCTTCGAGGCGGCGCACA
TCGGAGGCGACACTTGGCGGCAAAATCGTAAAAAGCAAGCATGCGAGGCC
AGTAAACGGCCATCGTCGATGATAATGGAGCACCGCAAGGGATCGATATC
GTTGTCGCAGCCCAACTCTCTGAACGATCCGCAATCGTTGCCACCCACGC
TGACCATCGACAAGTATGAGTCCGGCCGAGCCGAGGCCATTGGAACGCTG
TGCAAGATCTTCTGTGCAAAGAAGACGGGCGAGGAGATTCTGCCCGTCTA
TCTGGCCCGCTTCTACATGGCATTGCAGCAGTGCCTGAAGATTACAGAGT
CGCGGGAATGCGACGAGACGTTGGCCAGCATCCTGCTGCATTCGAGTGAC
CTGTTTCGCCTGGACCTGGATGGGATTAATGTGCTGCTGCCCGGTTTCAT
TGCCGCCTTGGAAATCGTACTGCCCGACAAGGACCTCAAGCTGAAGACGC
AATCGATGGTCTTTAATCGCACCGAATTGCGCCGTTCGGCGATTAACATC
CTGCTGTCCATCATGGTGCTGCCGTTGCACTACCAAACGCTGCCCATTCG
GGATTTGACCTGCGAATCGAGCGAGAAAATGTTTACCTTCATCCAACTGA
AGTCGCGGCTCATGAACATCTTGATGAATGCCCTGCAGGTCGAGACGGAT
GCCCAAAACACGCACATGCTTCTGGGCGGCCTGCTGCTCTGCGTTCAGGA
TGCCGTCACCTTCGAGGAGACGGAACTGGGCGGCGGCAATGCCAATCTCT
CGCAGAACTCGAGTGGTGTGCAGCATCATGACGCCAATCTACTGAGTTCG
GCGTGCTCGGAGCGTTCCGCTTCGCTGGTCAGCGCTGGCACAGCCAGCTT
GGGCGGTCAGACGACGGCCACCATGGGAGCGGGATCGGGCTCCATTCGCG
ACACCGCCTCCGCCCACGACTACCCCAGTCTGACCATATCCGATGACATG
TCATTCGAGTTCGGCCAGGAACTGGAAGGGGTGACCACCTATGATAATGC
CCATGCTCTATTTGTGCGCGCCACGTATTTGGTCTGCCATCGTCTGATCT
CGTCGTGGAAGACGGATCTGAATGTTTCGCTGGCCGCCTTGGAGTTGCTG
TCCGGCTTGGCCAGGTTACATATCCGGGAAACAGACGCTCTAGAGTGCAA
GCGGGCCGTGAAGTGGATCTGTGACTATATATGCTACCAGTGCTCCCGTC
CGCCGCCGGCGCATAGCAAGGATCTGCACAGCACCATTGTGGCGGCCTTT
CAGTGCACCGCCGCCTGGCTGATGCAGCATCCCTATTTGCTGCAGGACAA
GGATTGCCTGCAAACGGTCCTCGAGGTGGTTGAGCTGGGCATTTCGGGCA
CCAAGAGCCAGAGCAAGGGCACCGATATACCCAAATTTAAGGACGAAAAG
GAGCTAAAGCCCGCCTCGATGAGAGTGCGAGATGCTGCTGAGAATCTGCT
GACAATTATCCTCGAGCAAGTGGGCTATTTCCCCAGCGAATGCGGTCCAG
AGTCCATATCCTCGCTATTGGATGAGCTGGCGCTCATGAAGCACTGCAAC
TCTATGGTGCCGGCGGCGGCGGCCAGCAGTGAGCAGGCCATTGCCAAGTT
TAAGTACTTTGTGACCGAGAACTCCACCATATTGGCACTGCTCGAGGAGC
CGTTGGGCAATGACCAGGATCCCCAACCCACAGTGACTCTGCTCATACGC
GGTCCCTTTGGTCGACATGCCTGGACCATGCAGTTGCGTCATCTGCCTCG
CAGTAAGTCTGGGATTAAGTACCATGCCATTAATCCTGGCAGGCCCATAC
CCATGAACGATGTGACGCAACGGCTGGATAGCGAGCAAAAGAACTTTCCC
GACGGCGTGGACAAAGTGCAACCGTGTGTGGCGGACTACTCTATACCCAC
CATCGAACAAATGCGCGAGCAATACGGCACTGCTGTCATACGGGAGCTGG
AGTCGTTGCTGGAGAACCAGAGCATTCACGAGAAACTGGCCTGGGCGGAG
GCGGACACCAGTGCGGATAGTTTGTCGCATGCCCAAGAATGTGTGCCGCC
AACGGTGTGCCACGAGTTCCATGCGGCGCGTCTATTTCTCTCACATTTTG
GTTTTCTGGGATTCGAGACGCGGAATCCACAGAATCCAGCTGAGGCACTG
GGCAATCCGCCACAGCGACCGCTAATCGTGCTGGACACCAAGTCCGCAGC
CTTCGCCGCCGATCTGGATCGTTTGGACAAGCTGAGTGCGAGGACGCACG
ACAGCGTTTATGTGTTCTATGTGAAGAGTGGCCAAACGAGTGCCCAGCAG
ATTATCGCCAATATGGGCGAGGAATCGTCTGCCAGCCATGATCCGCACTT
CGCTAGCATGCTGCAAACGCTGGGCTGGCCGGTTCAGGTTTCAGAACACT
CTGGCTGGACGGGCTTTGCCCACAACTCGTGGTCACTCAAGGGAACGCCC
GAGGAGCAGCTAAAGTCCACTGCCAACGAGCTGAACTATAATGGATCACA
GAGGGTGCTCTACTGGGCGGATGTGTCATCGGAAATCGCCTTCGTGGTGC
CCACGACATGGAATCTGCGTTACAATAGCGACACTTGCGATAGTGGAAGT
ATCTCGAGCACGGATCAGATTGGCTCCAGCAATGTCTGGACACGCGGAGA
GGCCGATAGTGCGGCTGGCCTGGCAAAATCCAAGTCAAGGAATCTTAGCC
TAGAACTCGACACGAATCGCAGGGATGTAAAGGAGCCAGTTCCGCCGACG
CGACGAAAAGGAAATGTGACGAAACCCACACTATTGGCCCAGGCGCCGGC
CAAAATCTTTTTGGTGTGGCTGGAGAGCTATGAGGATTACCTAAACTTTC
CGCTCGAGGATCTGCTAGCCTATACACGCACTGGCGAGGAGCTGCAGACG
CAACAGTTGCCTCGCGCCTCCGACTGTCACGTGATCTTCGTGCATTCGTT
GCTCTCGGGACTTCTGAGAGTAAAGTTGCAGGGTCCACCGGGAAGGATGA
GCTTTGCCACGCCCCTGGTCGATGGCATGGTCCTGAGCCGGCGGGTAGTC
GGAAATCTGGTTCGACAAACGGCATTGAACATATCACGCCGCCGGCGTCT
GGACAATGATAACTACCAACCGCCTCATGTGCGACGACGACTCAAGGTGC
AGGACATTGTCCAGAAGTACAAAATGGATCTGAGCGAGGCCGATCTGTTG
GCCCATCTGTTCCAACGCGCAATTTAGCCGGCTATCGGAAGTATTATTAA
CCCGCTACCTAGTTTAAGAGCCAGAGAAGTGGTCTTTTCTATATTCTGTA
TTAACGTGTGCTTAACTAAAACCCCAAAACAAAACTGATCCATAATCGGT
GTCCACTGAGTGTTACCCGATTGATTATCGTATGCTAATTATTATTTATT
GCTAATAAATCGAATTATACTTTGTAAAAAAAAAAAAAAAAAA

FI03655.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG34408-RA 5469 CG34408-RA 34..5262 1..5229 26145 100 Plus
CG34408-RB 6027 CG34408-RB 2091..5820 1500..5229 18650 100 Plus
CG34408.a 5247 CG34408.a 12..2946 1..2935 14675 100 Plus
CG34408.a 5247 CG34408.a 2944..5231 2942..5229 11440 100 Plus
CG34408-RB 6027 CG34408-RB 34..1535 1..1502 7510 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 01:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10120307..10121151 4068..4912 4105 99.1 Plus
chrX 22417052 chrX 10111747..10112367 1..622 2985 99.4 Plus
chrX 22417052 chrX 10119667..10120253 3490..4076 2845 99 Plus
chrX 22417052 chrX 10119044..10119601 2932..3489 2760 99.6 Plus
chrX 22417052 chrX 10116832..10117375 1834..2377 2660 99.3 Plus
chrX 22417052 chrX 10113491..10113889 841..1239 1950 99.2 Plus
chrX 22417052 chrX 10121227..10121539 4913..5225 1565 100 Plus
chrX 22417052 chrX 10113950..10114212 1239..1501 1210 97.3 Plus
chrX 22417052 chrX 10117439..10117662 2378..2601 1120 100 Plus
chrX 22417052 chrX 10112986..10113209 619..842 1105 99.6 Plus
chrX 22417052 chrX 10115951..10116144 1499..1692 970 100 Plus
chrX 22417052 chrX 10117820..10118016 2601..2797 940 98.5 Plus
chrX 22417052 chrX 10118155..10118296 2793..2934 710 100 Plus
chrX 22417052 chrX 10116560..10116700 1693..1833 705 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34408-RA 4599 CG34408-PA 1..4599 429..5027 22995 100 Plus
CG34408-RH 5187 CG34408-PH 1660..5187 1500..5027 17640 100 Plus
CG34408-RB 5157 CG34408-PB 1630..5157 1500..5027 17640 100 Plus
CG34408-RH 5187 CG34408-PH 443..1104 841..1502 3310 100 Plus
CG34408-RH 5187 CG34408-PH 1..412 429..840 2060 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:56 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34408-RA 5236 CG34408-RA 12..5236 1..5225 26125 100 Plus
CG34408-RH 5824 CG34408-RH 2099..5824 1500..5225 18630 100 Plus
CG34408-RB 5794 CG34408-RB 2069..5794 1500..5225 18630 100 Plus
CG34408-RH 5824 CG34408-RH 12..851 1..840 4200 100 Plus
CG34408-RH 5824 CG34408-RH 882..1543 841..1502 3310 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 01:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG34408-PA 1532 CG34408-PA 1..1532 429..5024 7459 100 Plus
CG34408-PD 1468 CG34408-PD 1..1468 429..5024 7004 95.2 Plus
CG34408-PH 1728 CG34408-PH 554..1728 1500..5024 5634 100 Plus
CG34408-PB 1718 CG34408-PB 544..1718 1500..5024 5634 100 Plus
CG34408-PE 1724 CG34408-PE 544..1724 1500..5024 5617 99.5 Plus
CG34408-PB 1718 CG34408-PB 1..359 429..1505 1832 99.7 Plus
CG34408-PH 1728 CG34408-PH 1..369 429..1505 1807 96.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10228663..10229507 4068..4912 4195 99.8 Plus
X 23542271 X 10220121..10220742 1..622 3110 100 Plus
X 23542271 X 10228023..10228609 3490..4076 2935 100 Plus
X 23542271 X 10227400..10227957 2932..3489 2790 100 Plus
X 23542271 X 10225191..10225734 1834..2377 2720 100 Plus
X 23542271 X 10221866..10222264 841..1239 1995 100 Plus
X 23542271 X 10229583..10229899 4913..5229 1585 100 Plus
X 23542271 X 10222325..10222587 1239..1501 1315 100 Plus
X 23542271 X 10221361..10221584 619..842 1120 100 Plus
X 23542271 X 10225798..10226021 2378..2601 1120 100 Plus
X 23542271 X 10224312..10224505 1499..1692 970 100 Plus
X 23542271 X 10226179..10226375 2601..2797 970 99.5 Plus
X 23542271 X 10226514..10226655 2793..2934 710 100 Plus
X 23542271 X 10224919..10225059 1693..1833 705 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10236761..10237605 4068..4912 4195 99.7 Plus
X 23527363 X 10228219..10228840 1..622 3110 100 Plus
X 23527363 X 10236121..10236707 3490..4076 2935 100 Plus
X 23527363 X 10235498..10236055 2932..3489 2790 100 Plus
X 23527363 X 10233289..10233832 1834..2377 2720 100 Plus
X 23527363 X 10229964..10230362 841..1239 1995 100 Plus
X 23527363 X 10237681..10237997 4913..5229 1585 100 Plus
X 23527363 X 10230423..10230685 1239..1501 1315 100 Plus
X 23527363 X 10229459..10229682 619..842 1120 100 Plus
X 23527363 X 10233896..10234119 2378..2601 1120 100 Plus
X 23527363 X 10232410..10232603 1499..1692 970 100 Plus
X 23527363 X 10234277..10234473 2601..2797 970 99.4 Plus
X 23527363 X 10234612..10234753 2793..2934 710 100 Plus
X 23527363 X 10233017..10233157 1693..1833 705 100 Plus
Blast to na_te.dros performed 2014-11-27 01:49:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2490..2535 1547..1592 140 78.3 Plus
TART-C 11124 TART-C TARTC 11124bp 9170..9230 1547..1606 140 72.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6763..6870 1546..1650 126 61.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6835..6882 1546..1593 123 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2397..2442 1547..1592 122 73.9 Plus

FI03655.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:06:31 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10121227..10121539 4913..5225 100   Plus
chrX 10120316..10121151 4077..4912 99 -> Plus
chrX 10119667..10120253 3490..4076 98 -> Plus
chrX 10119047..10119601 2935..3489 99 -> Plus
chrX 10118156..10118296 2794..2934 100 -> Plus
chrX 10117821..10118012 2602..2793 98 -> Plus
chrX 10117439..10117662 2378..2601 100 -> Plus
chrX 10116832..10117375 1834..2377 99 -> Plus
chrX 10116560..10116700 1693..1833 100 -> Plus
chrX 10115953..10116144 1501..1692 100 -> Plus
chrX 10113951..10114211 1240..1500 97 -> Plus
chrX 10113491..10113889 841..1239 99 -> Plus
chrX 10112988..10113207 621..840 99 -> Plus
chrX 10111747..10112365 1..620 96 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:45:07 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 1..4599 429..5027 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:04 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 1..4599 429..5027 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:37:13 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 1..4599 429..5027 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:29 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 1..4599 429..5027 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:06:31 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 1..4599 429..5027 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:29:23 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 12..5236 1..5225 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:04 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 12..5236 1..5225 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:37:13 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 12..5236 1..5225 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:29 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 12..5236 1..5225 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:06:31 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
CG34408-RA 12..5236 1..5225 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:06:31 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
X 10229583..10229895 4913..5225 100   Plus
X 10228672..10229507 4077..4912 100 -> Plus
X 10228023..10228609 3490..4076 100 -> Plus
X 10227403..10227957 2935..3489 100 -> Plus
X 10226515..10226655 2794..2934 100 -> Plus
X 10226180..10226371 2602..2793 100 -> Plus
X 10225798..10226021 2378..2601 100 -> Plus
X 10225191..10225734 1834..2377 100 -> Plus
X 10224919..10225059 1693..1833 100 -> Plus
X 10224314..10224505 1501..1692 100 -> Plus
X 10222326..10222586 1240..1500 100 -> Plus
X 10221866..10222264 841..1239 100 -> Plus
X 10221363..10221582 621..840 100 -> Plus
X 10220121..10220740 1..620 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:37:13 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10123616..10123928 4913..5225 100   Plus
arm_X 10122705..10123540 4077..4912 100 -> Plus
arm_X 10122056..10122642 3490..4076 100 -> Plus
arm_X 10121436..10121990 2935..3489 100 -> Plus
arm_X 10120548..10120688 2794..2934 100 -> Plus
arm_X 10120213..10120404 2602..2793 100 -> Plus
arm_X 10119831..10120054 2378..2601 100 -> Plus
arm_X 10119224..10119767 1834..2377 100 -> Plus
arm_X 10118952..10119092 1693..1833 100 -> Plus
arm_X 10118347..10118538 1501..1692 100 -> Plus
arm_X 10116359..10116619 1240..1500 100 -> Plus
arm_X 10115899..10116297 841..1239 100 -> Plus
arm_X 10115396..10115615 621..840 100 -> Plus
arm_X 10114154..10114773 1..620 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:57 Download gff for FI03655.complete
Subject Subject Range Query Range Percent Splice Strand
X 10237681..10237993 4913..5225 100   Plus
X 10236770..10237605 4077..4912 100 -> Plus
X 10236121..10236707 3490..4076 100 -> Plus
X 10235501..10236055 2935..3489 100 -> Plus
X 10234613..10234753 2794..2934 100 -> Plus
X 10234278..10234469 2602..2793 100 -> Plus
X 10233896..10234119 2378..2601 100 -> Plus
X 10233289..10233832 1834..2377 100 -> Plus
X 10233017..10233157 1693..1833 100 -> Plus
X 10232412..10232603 1501..1692 100 -> Plus
X 10230424..10230684 1240..1500 100 -> Plus
X 10229964..10230362 841..1239 100 -> Plus
X 10229461..10229680 621..840 100 -> Plus
X 10228219..10228838 1..620 100 -> Plus

FI03655.pep Sequence

Translation from 428 to 5026

> FI03655.pep
MYSEWASLSAQITANSCGAQCFSVLNKFPASAGREVVVSVVKQLGTNLGI
TQNAEPSHLVKDEEVKWCMDVICFGLSLPLQEHETIKDCVNVYCEWLTAL
HPQPRISVPKPICEDANLYARQIINHFHNLFVPRQGESADTIKRQAVLCH
RVLRTLQQTAQISQLMDRQTWDTLLLFLLAINEILLAPPTVKDDVGDQLC
ERVLSVLFEVWLLACVRSFPSPSMWKTLQESCAMWRHRVALVDQWNRVNL
ALTARLLEFSYGPAFPQLKNADEDGQLIPIGMSNDCVAQTWYRFLRMIGN
PTALCSPHIISKSSHFVQWALTHEKGAETHQHPCLQQLPQIFLNAMKGIS
SQVDAFLGLSKTSLIGLTGGGARNAISSSSTTTTNAGSTGGTGSGDGSAP
APLPTTPTSTSGPPSASSSINSLPLTSMGAGVELAVARPKCNSILHVFHE
WLFEAAHIGGDTWRQNRKKQACEASKRPSSMIMEHRKGSISLSQPNSLND
PQSLPPTLTIDKYESGRAEAIGTLCKIFCAKKTGEEILPVYLARFYMALQ
QCLKITESRECDETLASILLHSSDLFRLDLDGINVLLPGFIAALEIVLPD
KDLKLKTQSMVFNRTELRRSAINILLSIMVLPLHYQTLPIRDLTCESSEK
MFTFIQLKSRLMNILMNALQVETDAQNTHMLLGGLLLCVQDAVTFEETEL
GGGNANLSQNSSGVQHHDANLLSSACSERSASLVSAGTASLGGQTTATMG
AGSGSIRDTASAHDYPSLTISDDMSFEFGQELEGVTTYDNAHALFVRATY
LVCHRLISSWKTDLNVSLAALELLSGLARLHIRETDALECKRAVKWICDY
ICYQCSRPPPAHSKDLHSTIVAAFQCTAAWLMQHPYLLQDKDCLQTVLEV
VELGISGTKSQSKGTDIPKFKDEKELKPASMRVRDAAENLLTIILEQVGY
FPSECGPESISSLLDELALMKHCNSMVPAAAASSEQAIAKFKYFVTENST
ILALLEEPLGNDQDPQPTVTLLIRGPFGRHAWTMQLRHLPRSKSGIKYHA
INPGRPIPMNDVTQRLDSEQKNFPDGVDKVQPCVADYSIPTIEQMREQYG
TAVIRELESLLENQSIHEKLAWAEADTSADSLSHAQECVPPTVCHEFHAA
RLFLSHFGFLGFETRNPQNPAEALGNPPQRPLIVLDTKSAAFAADLDRLD
KLSARTHDSVYVFYVKSGQTSAQQIIANMGEESSASHDPHFASMLQTLGW
PVQVSEHSGWTGFAHNSWSLKGTPEEQLKSTANELNYNGSQRVLYWADVS
SEIAFVVPTTWNLRYNSDTCDSGSISSTDQIGSSNVWTRGEADSAAGLAK
SKSRNLSLELDTNRRDVKEPVPPTRRKGNVTKPTLLAQAPAKIFLVWLES
YEDYLNFPLEDLLAYTRTGEELQTQQLPRASDCHVIFVHSLLSGLLRVKL
QGPPGRMSFATPLVDGMVLSRRVVGNLVRQTALNISRRRRLDNDNYQPPH
VRRRLKVQDIVQKYKMDLSEADLLAHLFQRAI*

FI03655.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19204-PA 1387 GF19204-PA 539..1072 358..841 2218 85.6 Plus
Dana\GF19204-PA 1387 GF19204-PA 1..359 1..359 1965 98.6 Plus
Dana\GF19204-PA 1387 GF19204-PA 1055..1387 1196..1532 1408 82.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18350-PA 1717 GG18350-PA 543..1717 358..1532 5962 96.2 Plus
Dere\GG18350-PA 1717 GG18350-PA 1..359 1..359 1987 99.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11710-PA 1687 GH11710-PA 598..1687 434..1532 4842 82.3 Plus
Dgri\GH11710-PA 1687 GH11710-PA 1..363 1..363 1884 92.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34408-PA 1532 CG34408-PA 1..1532 1..1532 7967 100 Plus
CG34408-PD 1468 CG34408-PD 1..1468 1..1532 7512 95.2 Plus
CG34408-PH 1728 CG34408-PH 554..1728 358..1532 6067 100 Plus
CG34408-PB 1718 CG34408-PB 544..1718 358..1532 6067 100 Plus
CG34408-PE 1724 CG34408-PE 544..1724 358..1532 6050 99.5 Plus
CG34408-PB 1718 CG34408-PB 1..359 1..359 1907 99.7 Plus
CG34408-PH 1728 CG34408-PH 1..369 1..359 1882 96.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16114-PA 1681 GI16114-PA 597..1681 434..1532 4947 84.4 Plus
Dmoj\GI16114-PA 1681 GI16114-PA 1..359 1..359 1895 94.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12887-PA 510 GL12887-PA 1..502 1..545 2051 76.5 Plus
Dper\GL12888-PA 287 GL12888-PA 1..271 610..874 1274 91.5 Plus
Dper\GL12889-PA 281 GL12889-PA 1..246 1034..1279 1022 76.4 Plus
Dper\GL12889-PA 281 GL12889-PA 243..281 1494..1532 195 92.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22490-PA 1766 GA22490-PA 566..1766 358..1532 5534 88.7 Plus
Dpse\GA22490-PA 1766 GA22490-PA 1..359 1..359 1962 98.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11415-PA 1675 GM11415-PA 545..1675 358..1532 5667 92.7 Plus
Dsec\GM11415-PA 1675 GM11415-PA 1..369 1..369 1988 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24698-PA 1613 GD24698-PA 442..1613 358..1532 6086 98 Plus
Dsim\GD24698-PA 1613 GD24698-PA 1..291 69..359 1621 99.7 Plus
Dsim\GD19992-PA 77 GD19992-PA 1..65 1..65 337 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16196-PA 1688 GJ16196-PA 599..1688 434..1532 4964 84.9 Plus
Dvir\GJ16196-PA 1688 GJ16196-PA 1..360 1..359 1891 94.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24981-PA 1756 GK24981-PA 618..1756 420..1532 5249 87 Plus
Dwil\GK24981-PA 1756 GK24981-PA 1..361 1..361 1857 92.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17839-PA 1720 GE17839-PA 544..1720 358..1532 6124 97.5 Plus
Dyak\GE17839-PA 1720 GE17839-PA 1..359 1..359 1987 99.7 Plus

FI03655.hyp Sequence

Translation from 428 to 5026

> FI03655.hyp
MYSEWASLSAQITANSCGAQCFSVLNKFPASAGREVVVSVVKQLGTNLGI
TQNAEPSHLVKDEEVKWCMDVICFGLSLPLQEHETIKDCVNVYCEWLTAL
HPQPRISVPKPICEDANLYARQIINHFHNLFVPRQGESADTIKRQAVLCH
RVLRTLQQTAQISQLMDRQTWDTLLLFLLAINEILLAPPTVKDDVGDQLC
ERVLSVLFEVWLLACVRSFPSPSMWKTLQESCAMWRHRVALVDQWNRVNL
ALTARLLEFSYGPAFPQLKNADEDGQLIPIGMSNDCVAQTWYRFLRMIGN
PTALCSPHIISKSSHFVQWALTHEKGAETHQHPCLQQLPQIFLNAMKGIS
SQVDAFLGLSKTSLIGLTGGGARNAISSSSTTTTNAGSTGGTGSGDGSAP
APLPTTPTSTSGPPSASSSINSLPLTSMGAGVELAVARPKCNSILHVFHE
WLFEAAHIGGDTWRQNRKKQACEASKRPSSMIMEHRKGSISLSQPNSLND
PQSLPPTLTIDKYESGRAEAIGTLCKIFCAKKTGEEILPVYLARFYMALQ
QCLKITESRECDETLASILLHSSDLFRLDLDGINVLLPGFIAALEIVLPD
KDLKLKTQSMVFNRTELRRSAINILLSIMVLPLHYQTLPIRDLTCESSEK
MFTFIQLKSRLMNILMNALQVETDAQNTHMLLGGLLLCVQDAVTFEETEL
GGGNANLSQNSSGVQHHDANLLSSACSERSASLVSAGTASLGGQTTATMG
AGSGSIRDTASAHDYPSLTISDDMSFEFGQELEGVTTYDNAHALFVRATY
LVCHRLISSWKTDLNVSLAALELLSGLARLHIRETDALECKRAVKWICDY
ICYQCSRPPPAHSKDLHSTIVAAFQCTAAWLMQHPYLLQDKDCLQTVLEV
VELGISGTKSQSKGTDIPKFKDEKELKPASMRVRDAAENLLTIILEQVGY
FPSECGPESISSLLDELALMKHCNSMVPAAAASSEQAIAKFKYFVTENST
ILALLEEPLGNDQDPQPTVTLLIRGPFGRHAWTMQLRHLPRSKSGIKYHA
INPGRPIPMNDVTQRLDSEQKNFPDGVDKVQPCVADYSIPTIEQMREQYG
TAVIRELESLLENQSIHEKLAWAEADTSADSLSHAQECVPPTVCHEFHAA
RLFLSHFGFLGFETRNPQNPAEALGNPPQRPLIVLDTKSAAFAADLDRLD
KLSARTHDSVYVFYVKSGQTSAQQIIANMGEESSASHDPHFASMLQTLGW
PVQVSEHSGWTGFAHNSWSLKGTPEEQLKSTANELNYNGSQRVLYWADVS
SEIAFVVPTTWNLRYNSDTCDSGSISSTDQIGSSNVWTRGEADSAAGLAK
SKSRNLSLELDTNRRDVKEPVPPTRRKGNVTKPTLLAQAPAKIFLVWLES
YEDYLNFPLEDLLAYTRTGEELQTQQLPRASDCHVIFVHSLLSGLLRVKL
QGPPGRMSFATPLVDGMVLSRRVVGNLVRQTALNISRRRRLDNDNYQPPH
VRRRLKVQDIVQKYKMDLSEADLLAHLFQRAI*

FI03655.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG34408-PA 1532 CG34408-PA 1..1532 1..1532 7967 100 Plus
CG34408-PD 1468 CG34408-PD 1..1468 1..1532 7512 95.2 Plus
CG34408-PH 1728 CG34408-PH 554..1728 358..1532 6067 100 Plus
CG34408-PB 1718 CG34408-PB 544..1718 358..1532 6067 100 Plus
CG34408-PE 1724 CG34408-PE 544..1724 358..1532 6050 99.5 Plus
CG34408-PB 1718 CG34408-PB 1..359 1..359 1907 99.7 Plus
CG34408-PH 1728 CG34408-PH 1..369 1..359 1882 96.7 Plus