Clone FI03659 Report

Search the DGRC for FI03659

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:59
Vector:pOT2
Associated Gene/TranscriptCG10616-RA
Protein status:FI03659.pep: gold
Sequenced Size:1707

Clone Sequence Records

FI03659.complete Sequence

1707 bp assembled on 2009-09-22

GenBank Submission: BT099806.1

> FI03659.complete
CCCAGCTCTAAAAATTTGTCATTTCGGAACGAATATAGTTAACATTAAAT
TTACGAAGTAAACAGAAACCCCAGAGCCACGATGCGCACAGTGCTGTTGA
GCAAACACGACGAGCTGTACCTGGAGAAATGCGCACAGGAGAACCAGTTC
TCGTACGGGATAATCGTGGGCCATCAAGCGGATCTCACCAAGAGCGTGGT
GGTCCACCTGGCCAGGAACAACGAGGAGGATGCGGATCTGGAGGACCTGT
CGGAGGTCCGGCTCACCATCTCGGACATCAACTCACAGGCATTGGCCTCC
CAGTGGCTGAGCGCCAGCAAAATGTGTCCCGGATCTTTTGACGTCATCGG
AATCTTTGTGTCTTCAGTAAGATCCGATGTAGTAAACGAACAGAGCGCCG
AATTTAAGAATGCCAAAAAGCTGTTTTCAGATATTTACGATTTGCTCCTG
AAAAGCAACAGCTCGTTTGGCGTCTACACCACCGACATTGCACAGACTGA
TTTCGTATTCCTCTCGTATTCGCTGGCCGACAAGAAAGTGCTCTGCAAGA
ACTACAGCTATGGCAACGGCGGCACTTTCACCAATATGGAGTTCCGGTTT
GTGGACAAACCCTTCGAGTGGATTCAGCTGGAGTGCAGCTACGATTTCGA
TGATGTGCTGCCCATACTGGACTCCTCGCGTCGCGTCAACATCGAAGACC
AGTTCCAGAGTATGATAGTGTCGGTGCGCAAGAACCTGCTCGCCAGTGAA
GTATTCCTCCAAAACGAAGTTGTCGAGGACACCATCGATCTGCAGGCCTA
TATCAAAAAGAAAAAGACGAAAGTGGACAAGCTGCAACCGACATCGACAA
CAGGTGGCACGGCCACTGCCTCGAGCAACACCACTGACTCCCTGCCGCGG
CTTGCGTCCGAAGGAATCATCGGAGGCACTGAAACCATCCGGGCGAGCAT
CGTGCTCCCCATGAAATGCCAGCTGAGCAAACCGACGGACATCAAGGTGC
GCGAATTTAGTGGCACGCTGCACATGAGCGGCATTATTACCTCAAAGGTA
TTCTGCAATCCTCGAAACAGTATAGCAGATGTTAAGCGTTTCCTACGCGA
CGATGTGCTCCGTTCGCTGATAACGCGTATACAAGTGTACTGCGATGGAC
TCACCGATCCATATGTGACCAATGAAGCTCTGTACATTAGTGAGCCGCCG
AGACGTGTGTTCTTCAGCCTGCCTTCAGAGGGTCCCAGTGCGTCGGTCGG
AGCAGTAGTTCAGTTTTCCGAGTACTTATTCCGTGGCGAGGCACCAACTG
TTGTGGTGGCCCAGGCTAAACAGATTCTGGACGTGGATCTAGATCCAGAG
ACCATATCCGTGGAGGCAGAGGGACTCCCGGATGATACGCACTTCAACAA
TTGCAAGATGGACGCTGATTGCATAGACGATTCTGGGATTATGACCAGTT
CGATGCCAAAGCCGGAACTTTCGCGCAGCCTTTACATGGTGGGAATCGCA
GTGGCCCTGCTGGTCCTCCTGTCCTCCGTGGCACTTCACTTTGTCCTAGC
CGAGCGGTAGGCAGCTGGGATGCTGGGATGACCGAACCAATAAACCAATT
TATATGAAATGTTTTTATACAGATACATTAATTGCATGTGTGCCCACGCA
CTCACCTCTCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAA

FI03659.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG10616-RA 2204 CG10616-RA 76..1737 1..1662 8310 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12463798..12464892 567..1661 5325 99.1 Plus
chr3L 24539361 chr3L 12462635..12462810 175..350 880 100 Plus
chr3L 24539361 chr3L 12462369..12462542 1..174 855 99.4 Plus
chr3L 24539361 chr3L 12463320..12463445 441..566 630 100 Plus
chr3L 24539361 chr3L 12463159..12463250 349..440 460 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG10616-RC 1479 CG10616-PC 1..1479 82..1560 7395 100 Plus
CG10616-RA 1479 CG10616-PA 1..1479 82..1560 7395 100 Plus
CG10616-RB 1527 CG10616-PB 534..1527 567..1560 4970 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:58 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG10616-RC 1838 CG10616-RC 29..1689 1..1661 8305 100 Plus
CG10616-RA 1689 CG10616-RA 29..1689 1..1661 8305 100 Plus
CG10616-RB 1737 CG10616-RB 643..1737 567..1661 5475 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG10616-PC 492 CG10616-PC 1..472 82..1497 2242 100 Plus
CG10616-PA 492 CG10616-PA 1..472 82..1497 2242 100 Plus
CG10616-PB 508 CG10616-PB 1..488 82..1497 2209 96.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12473185..12474280 567..1662 5480 100 Plus
3L 28110227 3L 12472022..12472197 175..350 880 100 Plus
3L 28110227 3L 12471756..12471929 1..174 870 100 Plus
3L 28110227 3L 12472707..12472832 441..566 630 100 Plus
3L 28110227 3L 12472546..12472637 349..440 460 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12466285..12467380 567..1662 5480 100 Plus
3L 28103327 3L 12465122..12465297 175..350 880 100 Plus
3L 28103327 3L 12464856..12465029 1..174 870 100 Plus
3L 28103327 3L 12465807..12465932 441..566 630 100 Plus
3L 28103327 3L 12465646..12465737 349..440 460 100 Plus
Blast to na_te.dros performed on 2014-11-26 20:02:09 has no hits.

FI03659.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:20:08 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12463798..12464892 567..1661 99   Plus
chr3L 12463320..12463445 441..566 100 -> Plus
chr3L 12463160..12463250 350..440 100 -> Plus
chr3L 12462635..12462809 175..349 100 -> Plus
chr3L 12462369..12462542 1..174 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:04 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
CG10616-RA 1..1479 82..1560 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:32:39 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
CG10616-RA 1..1479 82..1560 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:55:26 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
CG10616-RA 1..1479 82..1560 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:20:08 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
CG10616-RA 1..1479 82..1560 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-22 10:50:17 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
CG10616-RA 1..1656 6..1661 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:32:39 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
CG10616-RA 33..1693 1..1661 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:55:26 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
CG10616-RA 29..1689 1..1661 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:20:08 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
CG10616-RA 29..1689 1..1661 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:20:08 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12473185..12474279 567..1661 100   Plus
3L 12472707..12472832 441..566 100 -> Plus
3L 12472547..12472637 350..440 100 -> Plus
3L 12472022..12472196 175..349 100 -> Plus
3L 12471756..12471929 1..174 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:55:26 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12466285..12467379 567..1661 100   Plus
arm_3L 12465807..12465932 441..566 100 -> Plus
arm_3L 12465647..12465737 350..440 100 -> Plus
arm_3L 12465122..12465296 175..349 100 -> Plus
arm_3L 12464856..12465029 1..174 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:17:08 Download gff for FI03659.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12466285..12467379 567..1661 100   Plus
3L 12465807..12465932 441..566 100 -> Plus
3L 12465647..12465737 350..440 100 -> Plus
3L 12465122..12465296 175..349 100 -> Plus
3L 12464856..12465029 1..174 100 -> Plus

FI03659.pep Sequence

Translation from 81 to 1559

> FI03659.pep
MRTVLLSKHDELYLEKCAQENQFSYGIIVGHQADLTKSVVVHLARNNEED
ADLEDLSEVRLTISDINSQALASQWLSASKMCPGSFDVIGIFVSSVRSDV
VNEQSAEFKNAKKLFSDIYDLLLKSNSSFGVYTTDIAQTDFVFLSYSLAD
KKVLCKNYSYGNGGTFTNMEFRFVDKPFEWIQLECSYDFDDVLPILDSSR
RVNIEDQFQSMIVSVRKNLLASEVFLQNEVVEDTIDLQAYIKKKKTKVDK
LQPTSTTGGTATASSNTTDSLPRLASEGIIGGTETIRASIVLPMKCQLSK
PTDIKVREFSGTLHMSGIITSKVFCNPRNSIADVKRFLRDDVLRSLITRI
QVYCDGLTDPYVTNEALYISEPPRRVFFSLPSEGPSASVGAVVQFSEYLF
RGEAPTVVVAQAKQILDVDLDPETISVEAEGLPDDTHFNNCKMDADCIDD
SGIMTSSMPKPELSRSLYMVGIAVALLVLLSSVALHFVLAER*

FI03659.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10428-PA 493 GF10428-PA 1..493 1..492 2085 79.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15576-PA 492 GG15576-PA 1..492 1..492 2353 94.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15403-PA 492 GH15403-PA 1..490 1..489 1818 69.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG10616-PC 492 CG10616-PC 1..492 1..492 2487 100 Plus
CG10616-PA 492 CG10616-PA 1..492 1..492 2487 100 Plus
CG10616-PB 508 CG10616-PB 1..508 1..492 2454 96.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13006-PA 491 GI13006-PA 1..489 1..489 1838 74.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25193-PA 483 GL25193-PA 1..483 1..492 1895 70.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10438-PA 483 GA10438-PA 1..483 1..492 1875 70.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25346-PA 466 GM25346-PA 1..466 1..492 2197 92.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14379-PA 492 GD14379-PA 1..492 1..492 2369 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12098-PA 494 GJ12098-PA 1..493 1..490 1804 73.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12521-PA 510 GK12521-PA 1..508 1..491 1913 71.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21903-PA 492 GE21903-PA 1..492 1..492 2336 93.5 Plus

FI03659.hyp Sequence

Translation from 81 to 1559

> FI03659.hyp
MRTVLLSKHDELYLEKCAQENQFSYGIIVGHQADLTKSVVVHLARNNEED
ADLEDLSEVRLTISDINSQALASQWLSASKMCPGSFDVIGIFVSSVRSDV
VNEQSAEFKNAKKLFSDIYDLLLKSNSSFGVYTTDIAQTDFVFLSYSLAD
KKVLCKNYSYGNGGTFTNMEFRFVDKPFEWIQLECSYDFDDVLPILDSSR
RVNIEDQFQSMIVSVRKNLLASEVFLQNEVVEDTIDLQAYIKKKKTKVDK
LQPTSTTGGTATASSNTTDSLPRLASEGIIGGTETIRASIVLPMKCQLSK
PTDIKVREFSGTLHMSGIITSKVFCNPRNSIADVKRFLRDDVLRSLITRI
QVYCDGLTDPYVTNEALYISEPPRRVFFSLPSEGPSASVGAVVQFSEYLF
RGEAPTVVVAQAKQILDVDLDPETISVEAEGLPDDTHFNNCKMDADCIDD
SGIMTSSMPKPELSRSLYMVGIAVALLVLLSSVALHFVLAER*

FI03659.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG10616-PC 492 CG10616-PC 1..492 1..492 2487 100 Plus
CG10616-PA 492 CG10616-PA 1..492 1..492 2487 100 Plus
CG10616-PB 508 CG10616-PB 1..508 1..492 2454 96.7 Plus