Clone FI03663 Report

Search the DGRC for FI03663

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:63
Vector:pOT2
Associated Gene/TranscriptGpdh-RB
Protein status:FI03663.pep: gold
Sequenced Size:1655

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Gpdh 2008-08-15 Release 5.9 accounting
Gpdh 2008-12-18 5.12 accounting

Clone Sequence Records

FI03663.complete Sequence

1655 bp assembled on 2008-08-11

GenBank Submission: BT044153.1

> FI03663.complete
CCGCGGTTTCGACGTGTCAGTTTGCAGTACAATTACAATTGATTAATCGC
GCCAAATCGCGGAGCCAAGTAGTACTTAGCAAGTAGCAAGAGGAAGCACA
TCAGCGAGTCCATCGACAACAATAACAAAATATGGCGGATAAAGTAAATG
TGTGCATTGTGGGCTCCGGCAACTGGGGTTCGGCCATAGCGAAAATCGTG
GGCGCCAATGCCGCCGCTCTGCCGGAGTTCGAGGAGCGTGTGACGATGTT
CGTCTACGAGGAGCTCATCGATGGCAAGAAGCTGACGGAGATTATCAACG
AGACGCACGAGAACGTCAAGTACCTGAAAGGACACAAGCTGCCCCCGAAT
GTGGTTGCCGTGCCCGACCTGGTTGAGGCCGCCAAGAACGCTGACATCCT
GATCTTCGTGGTGCCCCACCAGTTCATTCCCAACTTCTGCAAACAGCTAC
TGGGCAAGATTAAGCCAAATGCCATCGCTATCTCCCTGATCAAGGGCTTC
GACAAGGCCGAGGGCGGCGGCATCGATCTGATCTCGCATATAATCACGCG
TCACCTGAAGATCCCATGCGCCGTGTTGATGGGCGCAAACCTGGCCAACG
AGGTGGCTGAGGGCAACTTCTGCGAAACGACAATCGGCTGCACGGACAAG
AAGTATGGCAAGGTGCTGCGCGATCTCTTCCAGGCGAACCACTTCCGCGT
GGTGGTCGTGGACGATGCTGATGCCGTGGAGGTTTGCGGTGCCCTCAAGA
ACATCGTGGCCTGCGGCGCTGGCTTTGTTGATGGCCTCAAGCTGGGCGAC
AACACCAAGGCGGCTGTCATCCGGCTGGGCCTCATGGAGATGATTCGCTT
CGTGGACGTCTTCTATCCCGGAAGCAAGCTGTCCACCTTCTTCGAGAGCT
GCGGCGTGGCCGATCTGATCACGACGTGTTACGGTGGCCGTAACCGCCGC
GTCTCTGAGGCGTTTGTGACTTCTGGAAAAACCATTGAGGAGCTGGAGAA
GGAAATGCTCAACGGCCAGAAGCTGCAGGGCCCACCCACTGCCGAGGAGG
TCAACTACATGCTGAAGAACAAGGGTCTGGAGGACAAATTCCCCCTGTTC
ACGGCTATTCACAAAATATGCACAAATCAGCTCAAGCCTAATGATTTAAT
TGATTGCATACGCAATCACCCTGAGCATATGGATACGTCCATCATGCCGT
CGCCAAAACTTTAAACTGTGTTACACCCAAACAAGATCAGTCAATGTATA
TTGTAAATACTATATATACCCGCATAGATCAAATCAACCAGTCATCTTCA
CCAAGGCCTATAAAGCTGGCATTATATAGATATATGCATAAAGTCAGAAA
AATCGTTCCACGTCAACTGCATTACTTTTTCCTCTAATTCTCGCAAGTGT
TTTTCAATGTGTACAGTGCTTAAGTGTTAGATAATCGAACCAAAACAAAG
AGTGTCATAATTGTTGAACCTAATTGGAATTGTTAAAATAAATATAAATT
AAATACAAGTTCTTTGTACATACCAACCAAAAGTGTTCCCAACTCATTTA
ACATTCAAAATTGGCAGCTGCAAATCGGCAAAGAGCAGTACGTACAAAAA
CTCCAAAATTAATAAATTTTGCAATTTTCAGTTAATCAAAAAAAAAAAAA
AAAAA

FI03663.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Gpdh-RB 1989 Gpdh-RB 315..1953 1..1639 8195 100 Plus
Gpdh.d 2212 Gpdh.d 315..1953 1..1639 8195 100 Plus
Gpdh.a 2587 Gpdh.a 315..1902 1..1588 7940 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5946904..5947364 1177..1637 2290 99.8 Plus
chr2L 23010047 chr2L 5945365..5945741 559..935 1885 100 Plus
chr2L 23010047 chr2L 5945094..5945301 353..560 1040 100 Plus
chr2L 23010047 chr2L 5943318..5943498 175..355 905 100 Plus
chr2L 23010047 chr2L 5943030..5943205 1..176 880 100 Plus
chr2L 23010047 chr2L 5946068..5946222 933..1087 775 100 Plus
chr2L 23010047 chr2L 5946291..5946384 1088..1181 470 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
Gpdh-RF 1083 CG9042-PF 1..1083 132..1214 5415 100 Plus
Gpdh-RB 1083 CG9042-PB 1..1083 132..1214 5415 100 Plus
Gpdh-RG 1062 CG9042-PG 1..1050 132..1181 5250 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:10:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Gpdh-RF 2503 CG9042-RF 337..1973 1..1637 8185 100 Plus
Gpdh-RB 1651 CG9042-RB 15..1651 1..1637 8185 100 Plus
Gpdh-RG 2078 CG9042-RG 337..1517 1..1181 5905 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
Gpdh-PF 360 CG9042-PF 1..360 132..1211 1743 100 Plus
Gpdh-PB 360 CG9042-PB 1..360 132..1211 1743 100 Plus
Gpdh-PE 350 CG9042-PE 1..350 132..1181 1692 100 Plus
Gpdh-PA 350 CG9042-PA 1..350 132..1181 1692 100 Plus
Gpdh-PG 353 CG9042-PG 1..350 132..1181 1692 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5947853..5948315 1177..1639 2300 99.8 Plus
2L 23513712 2L 5946314..5946690 559..935 1885 100 Plus
2L 23513712 2L 5946043..5946250 353..560 1040 100 Plus
2L 23513712 2L 5944267..5944447 175..355 905 100 Plus
2L 23513712 2L 5943979..5944154 1..176 880 100 Plus
2L 23513712 2L 5947017..5947171 933..1087 775 100 Plus
2L 23513712 2L 5947240..5947333 1088..1181 470 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5947853..5948315 1177..1639 2300 99.7 Plus
2L 23513712 2L 5946314..5946690 559..935 1885 100 Plus
2L 23513712 2L 5946043..5946250 353..560 1040 100 Plus
2L 23513712 2L 5944267..5944447 175..355 905 100 Plus
2L 23513712 2L 5943979..5944154 1..176 880 100 Plus
2L 23513712 2L 5947017..5947171 933..1087 775 100 Plus
2L 23513712 2L 5947240..5947333 1088..1181 470 100 Plus
Blast to na_te.dros performed 2014-11-26 20:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 1152..1229 1448..1526 122 65 Plus

FI03663.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:42:06 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5946908..5947364 1181..1637 94   Plus
chr2L 5946291..5946383 1088..1180 100 -> Plus
chr2L 5946069..5946222 934..1087 100 -> Plus
chr2L 5945367..5945739 561..933 100 -> Plus
chr2L 5945095..5945301 354..560 100 -> Plus
chr2L 5943319..5943496 176..353 100 -> Plus
chr2L 5943030..5943204 1..175 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:45:15 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 1..1083 132..1214 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:09:44 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 1..1083 132..1214 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:18:35 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 1..1083 132..1214 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:14 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 1..1083 132..1214 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:42:06 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 1..1083 132..1214 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:49:05 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 298..1934 1..1637 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:09:44 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 298..1934 1..1637 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:18:35 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 15..1651 1..1637 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-11 09:29:19 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 298..1934 1..1637 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:42:06 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
Gpdh-RB 15..1651 1..1637 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:42:06 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5947857..5948313 1181..1637 100   Plus
2L 5947240..5947332 1088..1180 100 -> Plus
2L 5947018..5947171 934..1087 100 -> Plus
2L 5946316..5946688 561..933 100 -> Plus
2L 5946044..5946250 354..560 100 -> Plus
2L 5944268..5944445 176..353 100 -> Plus
2L 5943979..5944153 1..175 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:18:35 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5947857..5948313 1181..1637 100   Plus
arm_2L 5947240..5947332 1088..1180 100 -> Plus
arm_2L 5947018..5947171 934..1087 100 -> Plus
arm_2L 5946316..5946688 561..933 100 -> Plus
arm_2L 5946044..5946250 354..560 100 -> Plus
arm_2L 5944268..5944445 176..353 100 -> Plus
arm_2L 5943979..5944153 1..175 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:39:39 Download gff for FI03663.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5947857..5948313 1181..1637 100   Plus
2L 5947240..5947332 1088..1180 100 -> Plus
2L 5947018..5947171 934..1087 100 -> Plus
2L 5946316..5946688 561..933 100 -> Plus
2L 5946044..5946250 354..560 100 -> Plus
2L 5944268..5944445 176..353 100 -> Plus
2L 5943979..5944153 1..175 100 -> Plus

FI03663.pep Sequence

Translation from 131 to 1213

> FI03663.pep
MADKVNVCIVGSGNWGSAIAKIVGANAAALPEFEERVTMFVYEELIDGKK
LTEIINETHENVKYLKGHKLPPNVVAVPDLVEAAKNADILIFVVPHQFIP
NFCKQLLGKIKPNAIAISLIKGFDKAEGGGIDLISHIITRHLKIPCAVLM
GANLANEVAEGNFCETTIGCTDKKYGKVLRDLFQANHFRVVVVDDADAVE
VCGALKNIVACGAGFVDGLKLGDNTKAAVIRLGLMEMIRFVDVFYPGSKL
STFFESCGVADLITTCYGGRNRRVSEAFVTSGKTIEELEKEMLNGQKLQG
PPTAEEVNYMLKNKGLEDKFPLFTAIHKICTNQLKPNDLIDCIRNHPEHM
DTSIMPSPKL*

FI03663.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 11:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Gpdh-PA 360 GF15589-PA 1..360 1..360 1897 99.7 Plus
Dana\GF13315-PA 358 GF13315-PA 2..354 3..349 1051 53.5 Plus
Dana\GF18443-PA 1391 GF18443-PA 1..350 1..355 839 44.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 11:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Gpdh-PA 360 GG25104-PA 1..360 1..360 1891 99.4 Plus
Dere\GG20063-PA 358 GG20063-PA 2..354 3..349 1037 53 Plus
Dere\GG11128-PA 1272 GG11128-PA 1..353 1..354 919 47.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 11:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11012-PA 360 GH11012-PA 1..360 1..360 1810 97.8 Plus
Dgri\GH23061-PA 359 GH23061-PA 1..356 1..350 1062 55.1 Plus
Dgri\GH20384-PA 349 GH20384-PA 7..347 7..348 877 45.9 Plus
Dgri\GH13333-PA 1631 GH13333-PA 7..353 7..354 866 45.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
Gpdh-PF 360 CG9042-PF 1..360 1..360 1875 100 Plus
Gpdh-PB 360 CG9042-PB 1..360 1..360 1875 100 Plus
Gpdh-PE 350 CG9042-PE 1..350 1..350 1824 100 Plus
Gpdh-PA 350 CG9042-PA 1..350 1..350 1824 100 Plus
Gpdh-PG 353 CG9042-PG 1..350 1..350 1824 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 11:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17532-PA 360 GI17532-PA 1..360 1..360 1873 98.1 Plus
Dmoj\GI21131-PA 359 GI21131-PA 1..356 1..350 1086 56.5 Plus
Dmoj\GI22380-PA 1383 GI22380-PA 1..353 1..354 885 45.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 11:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\Gpdh-PA 360 GL19044-PA 1..360 1..360 1885 98.9 Plus
Dper\GL11294-PA 389 GL11294-PA 30..385 1..349 1044 53.7 Plus
Dper\GL24207-PA 1442 GL24207-PA 1..353 1..353 936 47 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 11:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16715-PA 360 GA16715-PA 1..356 1..349 1045 53.7 Plus
Dpse\GA16060-PC 1457 GA16060-PC 1..353 1..353 934 46.7 Plus
Dpse\GA16060-PB 1628 GA16060-PB 187..524 16..353 886 46.4 Plus
Dpse\GA25323-PA 75 GA25323-PA 1..74 1..74 383 97.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 11:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15578-PA 358 GM15578-PA 2..354 3..349 1043 53.3 Plus
Dsec\GM18581-PA 84 GM18581-PA 1..71 1..71 345 94.4 Plus
Dsec\GM26425-PA 119 GM26425-PA 1..95 1..95 232 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 11:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Gpdh-PA 360 GD23370-PA 1..360 1..360 1902 100 Plus
Dsim\GD25078-PA 358 GD25078-PA 2..354 3..349 1036 53 Plus
Dsim\GD20943-PA 1130 GD20943-PA 1..347 1..348 902 47.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 11:25:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Gpdh-PA 360 GJ15413-PA 1..360 1..360 1867 98.1 Plus
Dvir\GJ15418-PA 288 GJ15418-PA 3..288 75..360 1490 98.6 Plus
Dvir\GJ20981-PA 359 GJ20981-PA 1..356 1..350 1086 55.3 Plus
Dvir\GJ24413-PA 957 GJ24413-PA 1..347 1..348 856 46.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 11:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\Gpdh-PA 360 GK14706-PA 1..360 1..360 1881 98.9 Plus
Dwil\GK19593-PA 358 GK19593-PA 2..354 3..349 1045 54.4 Plus
Dwil\GK14264-PA 1646 GK14264-PA 6..352 7..354 972 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 11:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Gpdh-PA 360 GE25734-PA 1..360 1..360 1902 100 Plus
Dyak\GE11600-PA 358 GE11600-PA 2..354 3..349 1038 53 Plus
Dyak\GE10294-PA 1278 GE10294-PA 1..353 1..354 919 46.9 Plus

FI03663.hyp Sequence

Translation from 131 to 1213

> FI03663.hyp
MADKVNVCIVGSGNWGSAIAKIVGANAAALPEFEERVTMFVYEELIDGKK
LTEIINETHENVKYLKGHKLPPNVVAVPDLVEAAKNADILIFVVPHQFIP
NFCKQLLGKIKPNAIAISLIKGFDKAEGGGIDLISHIITRHLKIPCAVLM
GANLANEVAEGNFCETTIGCTDKKYGKVLRDLFQANHFRVVVVDDADAVE
VCGALKNIVACGAGFVDGLKLGDNTKAAVIRLGLMEMIRFVDVFYPGSKL
STFFESCGVADLITTCYGGRNRRVSEAFVTSGKTIEELEKEMLNGQKLQG
PPTAEEVNYMLKNKGLEDKFPLFTAIHKICTNQLKPNDLIDCIRNHPEHM
DTSIMPSPKL*

FI03663.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Gpdh-PF 360 CG9042-PF 1..360 1..360 1875 100 Plus
Gpdh-PB 360 CG9042-PB 1..360 1..360 1875 100 Plus
Gpdh-PE 350 CG9042-PE 1..350 1..350 1824 100 Plus
Gpdh-PA 350 CG9042-PA 1..350 1..350 1824 100 Plus
Gpdh-PG 353 CG9042-PG 1..350 1..350 1824 100 Plus