Clone FI03671 Report

Search the DGRC for FI03671

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:71
Vector:pOT2
Associated Gene/TranscriptCG3308-RA
Protein status:FI03671.pep: gold
Sequenced Size:2141

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3308 2008-08-15 Release 5.9 accounting
CG3308 2008-12-18 5.12 accounting

Clone Sequence Records

FI03671.complete Sequence

2141 bp assembled on 2008-08-11

GenBank Submission: BT044155.1

> FI03671.complete
TTCAACTCTAGCCAGCAGTTGTAGTTCGTGTCGGGATTGTTTTTTAGATT
AATATTTCTCAACTTTTAGACCATTGATTGCCGAATTGGTCAACTCTTCC
AAATTCCAACAAATTCAGTAGATCCACATTTCACGGCTTTCACCGCCGTC
GCGTTTCCTTGCGCCCTCAAAAACAAGCTAATTGAATTACCCACGCACAC
AGTCGCAGCCCAGCAATCCATCGCCTGCGTCATAAGCTATTTTCGTCGAT
AATAGATCCAAGATTCCGATCCAGAACATGGACCCCAGTCAACAGACGCC
CCAGGAGACGGTGGTGGCCCCCGTGGCCCCGCTGCTGGAGGATCAGCTGG
AATTGGACATGAAGCACTGCTTTGAGAACCTGATCGTCATCGACGTGGGT
GCGAATCTGACCAACAAGAAGTATAGCCGTGATCTGGATTCCGTGGTGCA
GAGAGCCAGAGACGCAGGTGTCCAGAAACTAATGGTTCACGGCACTTCGG
TCAAATCGAGCAAGGAAGCGCTGCGCCTTTCGCGCATCTATCCCGACATA
ATCTACTCAACTGCTGGCATTCACCCGCACGACTCCAAGTCCATCGTGGA
AGAGCCGGCCACGTGGTTCGATCTGGAGCACATCGCCCAGGCGCAGGAGT
GTGTGGCGATTGGCCCCTGCGGCTTGGACTACCAGCGGGACTTCTCCGAA
CCGGACGCCCAGAAGCAGATCTTCGCCAAGCAGCTGCATCTGGCCATCCG
GCTAAATAAACCTCTGCTGATCCACGAGCGGTCGGCTCAGCTCGATTTAC
TCGAAATACTAGACAAATTCGAGAATCTTCCGCCTGTGATCATCAGAGGT
TTTATGGGCACCGCCGAGGAGGCGCTTAAGTACCTAGACCGGAGGTTCTA
CATCAGCCTGACGGGCTACCTGTGCAAGGACAAATCGGATACTGGCGTTC
GCCGCCTGCTGGAGGACGGCACATTGCCGCTAGACAGACTACTGGTGGAG
ACGGATGCTCCTTTCATGTACCCAAACACAAGGGCTTCCAAGCTACCGCA
ACACGTGAAGACTGGTATCACCGAACGCTCATTGTTGTACTTACACAGAT
ATTGTACCTTCCAACGCAACGAGCCGTGCAGTTTGCCCGCCATTGTAGAG
ATGATAGCCGCCTTCATGAAGAAAAGCCCGGACGAGGTGGCTTTGGCCAC
TGCCTTTAATGCCCTGAAACTGTTTGGCTTGTCCTAGAAAATGGTAAAGG
AGCCACATGGAACTGAACGACAAAGTGTGCCACCCAGCAGCTTTAAACCC
GTAACTCTATAGATTCAACGAGCCTGAGATTCACGATAGACTCATACCTA
TGTGCCTTAACCACTAATCGAATTCAGGATGAAGCGCTTATCCTGATCCC
CACACATACACACATCCACAAATACGACCCCCATTGCATGCGAAAAGTAC
GTATACGTATATAACTATATATTCACCCCCTGCCGTAAAGGTGCAAACCA
TCGATCGAAGTTTGCAGGGTCTAGCTTTAAGTTGTTGGAATTTCCGAGCA
ATTGCTTTATTTACTCGAGTACCCAGAGAAACGGTGCCAAGGTGGTGCCT
CGTGAACGTCGACTCCGGATTCGCCCGGGGTCTGCACTTCACGCCTCGAA
GCGCGCGCTTCGAACTCGCTCCCGAAGCGATATATGTTAATGTTAAGTGC
TGCAGCTTGTCTTTTGTTTGTTTCTTCTGTATTTAGGCTAGAATCAATAC
TTTTAGTTTGTGTCTCTGTTAGCCTGTAGTCGTACTTTTGTACATATTTA
TTCTTGTTGCGACGATGACGATGATGATGATGATTATGGGAAACGTAATG
TGATCATTTTAAAAGCTAATTAGTTATTTGATATTCAACATACAAACACA
TTAGTTAGGCTATGAAACATATTGAATATCGTGCGCCTATACAAACTATA
TATGTATTGTTATATTTACATATACAAAAGCGTTGTACTGAACTGATCGA
CCCGCGGAGGTTGCATAAAATCCGCTTTGTGCCCATTGTCCGCACACAGA
CACACACTATTTTCCATTTGAATAAAGCGAATTTGAAACCCAAACGAACA
AAAGCCCCTTTTAGAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI03671.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG3308-RA 2193 CG3308-RA 80..2193 1..2114 10570 100 Plus
CG5919.a 1236 CG5919.a 843..1236 2115..1722 1970 100 Minus
CG5919-RB 1332 CG5919-RB 939..1332 2115..1722 1970 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17094907..17095921 2114..1096 5000 99.6 Minus
chr3R 27901430 chr3R 17097164..17097632 469..1 2345 100 Minus
chr3R 27901430 chr3R 17096312..17096664 816..464 1765 100 Minus
chr3R 27901430 chr3R 17095980..17096261 1098..817 1410 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG3308-RA 960 CG3308-PA 1..960 278..1237 4800 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:04 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3308-RA 2124 CG3308-RA 11..2124 1..2114 10570 100 Plus
CG5919-RA 1227 CG5919-RA 897..1227 2114..1784 1655 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG3308-PA 319 CG3308-PA 1..319 278..1234 1642 100 Plus
CG3358-PG 291 CG3358-PG 10..283 416..1225 272 31.4 Plus
CG3358-PF 291 CG3358-PF 10..283 416..1225 272 31.4 Plus
CG3358-PE 291 CG3358-PE 10..283 416..1225 272 31.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21271077..21272096 2115..1096 5100 100 Minus
3R 32079331 3R 21273339..21273807 469..1 2345 100 Minus
3R 32079331 3R 21272487..21272839 816..464 1765 100 Minus
3R 32079331 3R 21272155..21272436 1098..817 1410 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21011908..21012927 2115..1096 5100 100 Minus
3R 31820162 3R 21014170..21014638 469..1 2345 100 Minus
3R 31820162 3R 21013318..21013670 816..464 1765 100 Minus
3R 31820162 3R 21012986..21013267 1098..817 1410 100 Minus
Blast to na_te.dros performed on 2014-11-27 03:34:11 has no hits.

FI03671.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:56:46 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17097166..17097632 1..467 100   Minus
chr3R 17096312..17096660 468..816 100 <- Minus
chr3R 17095980..17096261 817..1098 100 <- Minus
chr3R 17094907..17095918 1099..2114 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:45:24 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 1..960 278..1237 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:08 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 1..960 278..1237 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:05:57 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 1..960 278..1237 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:23 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 1..960 278..1237 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:56:46 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 1..960 278..1237 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:49:36 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 7..2120 1..2114 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:08 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 9..2122 1..2114 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:05:57 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 11..2124 1..2114 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-11 09:29:18 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 7..2120 1..2114 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:56:46 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
CG3308-RA 11..2124 1..2114 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:56:46 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21273341..21273807 1..467 100   Minus
3R 21272487..21272835 468..816 100 <- Minus
3R 21272155..21272436 817..1098 100 <- Minus
3R 21271078..21272093 1099..2114 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:05:57 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17099063..17099529 1..467 100   Minus
arm_3R 17098209..17098557 468..816 100 <- Minus
arm_3R 17097877..17098158 817..1098 100 <- Minus
arm_3R 17096800..17097815 1099..2114 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:07 Download gff for FI03671.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21014172..21014638 1..467 100   Minus
3R 21013318..21013666 468..816 100 <- Minus
3R 21012986..21013267 817..1098 100 <- Minus
3R 21011909..21012924 1099..2114 100 <- Minus

FI03671.pep Sequence

Translation from 277 to 1236

> FI03671.pep
MDPSQQTPQETVVAPVAPLLEDQLELDMKHCFENLIVIDVGANLTNKKYS
RDLDSVVQRARDAGVQKLMVHGTSVKSSKEALRLSRIYPDIIYSTAGIHP
HDSKSIVEEPATWFDLEHIAQAQECVAIGPCGLDYQRDFSEPDAQKQIFA
KQLHLAIRLNKPLLIHERSAQLDLLEILDKFENLPPVIIRGFMGTAEEAL
KYLDRRFYISLTGYLCKDKSDTGVRRLLEDGTLPLDRLLVETDAPFMYPN
TRASKLPQHVKTGITERSLLYLHRYCTFQRNEPCSLPAIVEMIAAFMKKS
PDEVALATAFNALKLFGLS*

FI03671.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 11:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17261-PA 318 GF17261-PA 14..318 17..319 1556 95.4 Plus
Dana\GF13149-PA 305 GF13149-PA 3..298 35..316 304 30.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 11:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14738-PA 319 GG14738-PA 1..319 1..319 1671 97.5 Plus
Dere\GG23234-PA 347 GG23234-PA 37..342 26..316 323 31.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 11:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18916-PA 326 GH18916-PA 3..326 5..319 1534 89.5 Plus
Dgri\GH22015-PA 273 GH22015-PA 3..268 35..316 250 29.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3308-PA 319 CG3308-PA 1..319 1..319 1642 100 Plus
CG3358-PG 291 CG3358-PG 10..283 47..316 272 31.4 Plus
CG3358-PF 291 CG3358-PF 10..283 47..316 272 31.4 Plus
CG3358-PE 291 CG3358-PE 10..283 47..316 272 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 11:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10834-PA 313 GI10834-PA 8..313 16..319 1541 93.8 Plus
Dmoj\GI19721-PA 303 GI19721-PA 3..298 35..316 334 33.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 11:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27162-PA 321 GL27162-PA 1..321 1..319 1587 92.8 Plus
Dper\GL11128-PA 293 GL11128-PA 4..283 41..316 281 30.3 Plus
Dper\GL15649-PA 185 GL15649-PA 1..175 143..316 164 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 11:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17263-PA 321 GA17263-PA 1..321 1..319 1585 92.5 Plus
Dpse\GA17403-PA 293 GA17403-PA 4..283 41..316 283 30.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 11:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15087-PA 310 GM15087-PA 1..301 1..301 1596 99.3 Plus
Dsec\GM20907-PA 306 GM20907-PA 6..298 38..316 315 32.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 11:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19994-PA 264 GD19994-PA 1..264 56..319 1409 100 Plus
Dsim\GD10435-PA 306 GD10435-PA 6..298 38..316 324 32.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 11:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14441-PA 324 GJ14441-PA 29..324 24..319 1519 95.3 Plus
Dvir\GJ17566-PA 303 GJ17566-PA 3..298 35..316 310 32 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 11:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12770-PA 312 GK12770-PA 16..312 23..319 1518 94.6 Plus
Dwil\GK20888-PA 304 GK20888-PA 3..298 35..316 304 31.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 11:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25001-PA 319 GE25001-PA 1..319 1..319 1688 99.1 Plus
Dyak\GE19085-PA 313 GE19085-PA 3..305 29..316 315 32.1 Plus

FI03671.hyp Sequence

Translation from 277 to 1236

> FI03671.hyp
MDPSQQTPQETVVAPVAPLLEDQLELDMKHCFENLIVIDVGANLTNKKYS
RDLDSVVQRARDAGVQKLMVHGTSVKSSKEALRLSRIYPDIIYSTAGIHP
HDSKSIVEEPATWFDLEHIAQAQECVAIGPCGLDYQRDFSEPDAQKQIFA
KQLHLAIRLNKPLLIHERSAQLDLLEILDKFENLPPVIIRGFMGTAEEAL
KYLDRRFYISLTGYLCKDKSDTGVRRLLEDGTLPLDRLLVETDAPFMYPN
TRASKLPQHVKTGITERSLLYLHRYCTFQRNEPCSLPAIVEMIAAFMKKS
PDEVALATAFNALKLFGLS*

FI03671.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:34:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG3308-PA 319 CG3308-PA 1..319 1..319 1642 100 Plus
CG3358-PG 291 CG3358-PG 10..283 47..316 272 31.4 Plus
CG3358-PF 291 CG3358-PF 10..283 47..316 272 31.4 Plus
CG3358-PE 291 CG3358-PE 10..283 47..316 272 31.4 Plus