Clone FI03672 Report

Search the DGRC for FI03672

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:72
Vector:pOT2
Associated Gene/TranscriptCG9855-RA
Protein status:FI03672.pep: gold
Sequenced Size:1552

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9855 2008-08-15 Release 5.9 accounting
CG9855 2008-12-18 5.12 accounting

Clone Sequence Records

FI03672.complete Sequence

1552 bp assembled on 2008-08-11

GenBank Submission: BT044156.1

> FI03672.complete
AATCATTGAAAGTGCCCTGGTAGAATAAATCAGATTGGGTTTATTTAGTT
AGTTTTATTTTCGTTGAACCACCCAAAATAAGAGTAAAGTTGAGAAACGC
TCAGAATTAAAGCCACAACCTTTAACCGAAAAGGCCAATCACCGCACAAC
AAAGCCGAGTGAGAGCAAACGAAATGGCCGACAAAGCTGCAGCGCCCTCT
GTGGACTGTGCGGCGCCATCTGTGGACTGTGCGACGCCTGCAATACCAGC
CGTGGAGGATCACACCACGCTGACCGTTCCACCTGCTTCAGCGAACAAAG
CCACGGACGCTTCCACTTCCACTGCCGTCCAAGTGGCCGTCGATGGGGGG
GAGCCGGAACGCTGCTGCTGGATCTGCTTCGCCACCGATGAGGACAACCG
TCTGGCGGCGTGGGTGAAGCCCTGTCAGTGCCGCGGCACCACCAAGTGGG
TGCACCAGAGCTGCCTCTACCGCTGGATCGATGAAAAAACCCAGAAGGGT
AACGCTCTACGCACTGTATCGTGTCCGCAGTGCCAAACGGAGTACATCAT
AGTGTTCCCGCAGATGGGCAAGCTTGGAGGTGCTTTAGAGGCAATAGATA
ACCTCATCAAGCGCCTGAGCCCCTTCCTGGCGGCTGGTTTCTTCGTGGGC
TCCCTCTACTGGACAGCAGTAACTTACGGAGCAGTCACATTTTTACAGAT
TGTCGGACATGAGCACGGCATGTCCATAATGGAGTCTGGAGATCCGCTCG
TTCTCCTTATTGGGTTGCCGGCTATTCCAGTGGGGCTTGTGCTTGGTCGA
TTGATTCGCTGGGAGGATGCATTGTTGCGTCTTATTCGAAACCGCGGGAC
GGTGGTGCGGAAGTTTCCTTTTGTAAGCCTTATTTATCCGAACCTCAGCC
AGGAAGAGGAACAGCAAAGCATCAGCAATCCGGCCACACCGGCTCTCTCT
GACCCTGTCTCAGCCACGAGGGTCTTCTGCGGCGCTCTCTTGCTGCCCAC
CATATCGTCGATCGTGGGACGTATTCTCTTTGACACGGTTGATAACACAT
TGCATCGTACTCTGCTTGGAGGTCTGACCTTTATAACGGTCAAGGGAATT
CTGAAAATTTATTTGAAGCAGAAACAGTACGGCCGCCGCAAGAAGCGCCG
AATTGTGGACTACACTGAGGAAAATATTCGGAACTTCATGCACCGCAACA
ATAACTCGGCAGCAGCGGCGCGGCAGGAAAGGCTGCCCGAGCAGAGGCCA
GTGCCACCAGCGGAGCGAAGGGACGCTGTAATCACACGTCAACGCGGCGA
TAGTGGTGGTAGCGTTGTCTAGAAGTAATTGGATTCAACTGTAGGGCCAC
TTATTTTCTACGAGTTATGGTTTGTTTTAAGTTAATTGTTTTACCTCTTG
CACTTTCAAGACGCTCACATCACCACCTAATTTAGGTGGACAAAAATTTT
TAATTGTCTGCAGATAACAAAGCTAAATTTATTGTTAAAGTACACTGTTT
AATGGCCGGAAAATAAATGTACATTAAAACGCTGAAAAAAAAAAAAAAAA
AA

FI03672.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG9855.a 1807 CG9855.a 44..1578 1..1535 7675 100 Plus
CG9855-RA 1972 CG9855-RA 206..1740 1..1535 7675 100 Plus
CG17991-RA 1070 CG17991-RA 173..258 407..492 190 81.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 221883..222521 1534..896 3195 100 Minus
chr3R 27901430 chr3R 222831..223359 698..170 2645 100 Minus
chr3R 27901430 chr3R 222579..222777 895..697 995 100 Minus
chr3R 27901430 chr3R 223427..223595 169..1 845 100 Minus
chr3R 27901430 chr3R 23064318..23064512 356..550 210 73.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG9855-RC 1149 CG9855-PC 1..1149 174..1322 5745 100 Plus
CG9855-RA 1149 CG9855-PA 1..1149 174..1322 5745 100 Plus
CG17991-RA 885 CG17991-PA 57..251 356..550 210 73.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:05 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG9855-RC 1718 CG9855-RC 1..1533 2..1534 7665 100 Plus
CG9855-RA 1533 CG9855-RA 1..1533 2..1534 7665 100 Plus
CG17991-RA 1064 CG17991-RA 122..316 356..550 210 73.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9855-PC 382 CG9855-PC 1..382 174..1319 1917 100 Plus
CG9855-PA 382 CG9855-PA 1..382 174..1319 1917 100 Plus
CG16781-PA 383 CG16781-PA 32..337 339..1208 705 47 Plus
CG16781-PB 386 CG16781-PB 35..340 339..1208 705 47 Plus
CG17991-PA 294 CG17991-PA 2..288 309..1178 680 52.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4396163..4396802 1535..896 3200 100 Minus
3R 32079331 3R 4397112..4397640 698..170 2645 100 Minus
3R 32079331 3R 4396860..4397058 895..697 995 100 Minus
3R 32079331 3R 4397708..4397876 169..1 845 100 Minus
3R 32079331 3R 27241388..27241582 356..550 210 73.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4136994..4137633 1535..896 3200 100 Minus
3R 31820162 3R 4137943..4138471 698..170 2645 100 Minus
3R 31820162 3R 4137691..4137889 895..697 995 100 Minus
3R 31820162 3R 4138539..4138707 169..1 845 100 Minus
3R 31820162 3R 26982270..26982355 407..492 190 81.3 Plus
Blast to na_te.dros performed on 2014-11-27 11:25:00 has no hits.

FI03672.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:47:24 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 223427..223595 1..169 100   Minus
chr3R 222831..223359 170..698 100 <- Minus
chr3R 222579..222775 699..895 100 <- Minus
chr3R 221883..222521 896..1534 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:45:27 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 1..1149 174..1322 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:03 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 1..1149 174..1322 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:31 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 1..1149 174..1322 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:22 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 1..1149 174..1322 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:47:24 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 1..1149 174..1322 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:49:30 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 12..1545 1..1534 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:03 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 12..1545 1..1534 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:31 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 1..1533 2..1534 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-11 09:29:23 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 12..1545 1..1534 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:47:24 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
CG9855-RA 1..1533 2..1534 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:47:24 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4397708..4397876 1..169 100   Minus
3R 4397112..4397640 170..698 100 <- Minus
3R 4396860..4397056 699..895 100 <- Minus
3R 4396164..4396802 896..1534 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:31 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 223430..223598 1..169 100   Minus
arm_3R 222834..223362 170..698 100 <- Minus
arm_3R 222582..222778 699..895 100 <- Minus
arm_3R 221886..222524 896..1534 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:01 Download gff for FI03672.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4138539..4138707 1..169 100   Minus
3R 4137943..4138471 170..698 100 <- Minus
3R 4137691..4137887 699..895 100 <- Minus
3R 4136995..4137633 896..1534 100 <- Minus

FI03672.pep Sequence

Translation from 173 to 1321

> FI03672.pep
MADKAAAPSVDCAAPSVDCATPAIPAVEDHTTLTVPPASANKATDASTST
AVQVAVDGGEPERCCWICFATDEDNRLAAWVKPCQCRGTTKWVHQSCLYR
WIDEKTQKGNALRTVSCPQCQTEYIIVFPQMGKLGGALEAIDNLIKRLSP
FLAAGFFVGSLYWTAVTYGAVTFLQIVGHEHGMSIMESGDPLVLLIGLPA
IPVGLVLGRLIRWEDALLRLIRNRGTVVRKFPFVSLIYPNLSQEEEQQSI
SNPATPALSDPVSATRVFCGALLLPTISSIVGRILFDTVDNTLHRTLLGG
LTFITVKGILKIYLKQKQYGRRKKRRIVDYTEENIRNFMHRNNNSAAAAR
QERLPEQRPVPPAERRDAVITRQRGDSGGSVV*

FI03672.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 11:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16812-PA 403 GF16812-PA 1..403 1..382 1610 79.4 Plus
Dana\GF21788-PA 469 GF21788-PA 60..380 51..365 955 56.2 Plus
Dana\GF20973-PA 346 GF20973-PA 32..344 56..351 582 37.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 11:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11621-PA 388 GG11621-PA 25..388 18..382 1838 94 Plus
Dere\GG18582-PA 384 GG18582-PA 54..354 62..358 817 50.2 Plus
Dere\GG11538-PA 306 GG11538-PA 27..300 57..335 788 53.7 Plus
Dere\GG17980-PA 325 GG17980-PA 29..324 60..341 576 39.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 11:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14233-PA 413 GH14233-PA 89..381 62..353 1413 87.7 Plus
Dgri\GH12186-PA 303 GH12186-PA 15..288 60..336 801 52.7 Plus
Dgri\GH24859-PA 290 GH24859-PA 5..289 62..331 471 34.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9855-PC 382 CG9855-PC 1..382 1..382 1992 100 Plus
CG9855-PA 382 CG9855-PA 1..382 1..382 1992 100 Plus
CG16781-PA 383 CG16781-PA 32..337 56..345 735 47 Plus
CG16781-PB 386 CG16781-PB 35..340 56..345 735 47 Plus
CG17991-PA 294 CG17991-PA 2..288 46..335 715 52.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 11:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22140-PA 421 GI22140-PA 26..360 29..341 1412 79.1 Plus
Dmoj\GI14409-PA 305 GI14409-PA 10..299 57..336 530 36.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 11:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22354-PA 389 GL22354-PA 1..369 1..360 1486 77.8 Plus
Dper\GL13124-PA 345 GL13124-PA 29..279 60..348 610 45 Plus
Dper\GL20188-PA 337 GL20188-PA 29..323 60..339 445 34.1 Plus
Dper\GL13782-PA 311 GL13782-PA 18..309 58..333 388 33.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 11:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22076-PB 398 GA22076-PB 1..376 1..360 1519 78.7 Plus
Dpse\GA23069-PA 404 GA23069-PA 46..337 60..350 761 49.8 Plus
Dpse\GA10551-PA 339 GA10551-PA 31..325 60..339 451 34.4 Plus
Dpse\GA26791-PA 311 GA26791-PA 18..309 58..333 385 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 11:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10705-PA 382 GM10705-PA 1..382 1..382 2009 98.4 Plus
Dsec\GM12725-PA 388 GM12725-PA 34..323 55..336 733 47.3 Plus
Dsec\GM10380-PA 285 GM10380-PA 15..279 57..335 595 46.8 Plus
Dsec\GM11202-PA 325 GM11202-PA 31..323 62..341 550 41.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 11:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19682-PA 382 GD19682-PA 1..382 1..382 1943 97.9 Plus
Dsim\GD16331-PA 388 GD16331-PA 34..323 55..336 737 46.5 Plus
Dsim\GD24575-PA 320 GD24575-PA 31..320 62..344 534 40.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 11:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24258-PA 420 GJ24258-PA 22..351 24..341 1441 82.1 Plus
Dvir\GJ19393-PA 367 GJ19393-PA 11..297 58..339 871 53.5 Plus
Dvir\GJ18757-PA 307 GJ18757-PA 12..300 57..335 518 36.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 11:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13759-PA 401 GK13759-PA 67..401 57..382 1466 82.6 Plus
Dwil\GK10150-PA 387 GK10150-PA 26..323 60..347 888 53.2 Plus
Dwil\GK10149-PA 307 GK10149-PA 24..301 60..333 665 45.4 Plus
Dwil\GK19914-PA 329 GK19914-PA 32..324 62..345 542 38 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 11:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25355-PA 374 GE25355-PA 17..374 24..382 1764 92.2 Plus
Dyak\GE16894-PA 387 GE16894-PA 38..329 62..348 773 50.8 Plus
Dyak\GE17474-PA 327 GE17474-PA 28..318 57..334 560 39.6 Plus

FI03672.hyp Sequence

Translation from 173 to 1321

> FI03672.hyp
MADKAAAPSVDCAAPSVDCATPAIPAVEDHTTLTVPPASANKATDASTST
AVQVAVDGGEPERCCWICFATDEDNRLAAWVKPCQCRGTTKWVHQSCLYR
WIDEKTQKGNALRTVSCPQCQTEYIIVFPQMGKLGGALEAIDNLIKRLSP
FLAAGFFVGSLYWTAVTYGAVTFLQIVGHEHGMSIMESGDPLVLLIGLPA
IPVGLVLGRLIRWEDALLRLIRNRGTVVRKFPFVSLIYPNLSQEEEQQSI
SNPATPALSDPVSATRVFCGALLLPTISSIVGRILFDTVDNTLHRTLLGG
LTFITVKGILKIYLKQKQYGRRKKRRIVDYTEENIRNFMHRNNNSAAAAR
QERLPEQRPVPPAERRDAVITRQRGDSGGSVV*

FI03672.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG9855-PC 382 CG9855-PC 1..382 1..382 1992 100 Plus
CG9855-PA 382 CG9855-PA 1..382 1..382 1992 100 Plus
CG16781-PA 383 CG16781-PA 32..337 56..345 735 47 Plus
CG16781-PB 386 CG16781-PB 35..340 56..345 735 47 Plus
CG17991-PA 294 CG17991-PA 2..288 46..335 715 52.4 Plus