Clone FI03673 Report

Search the DGRC for FI03673

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:73
Vector:pOT2
Associated Gene/TranscriptCG12582-RA
Protein status:FI03673.pep: gold
Sequenced Size:2944

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12582 2008-08-15 Release 5.9 accounting
CG12582 2008-12-18 5.12 accounting

Clone Sequence Records

FI03673.complete Sequence

2944 bp assembled on 2008-08-11

GenBank Submission: BT044157.1

> FI03673.complete
TCAGTGGAAGAACTCCACGTTTTGCTGAACGCTCAGAGTGCTTTTTGTCG
AACAGAGGAGTCGTCTTTAAAGTAGCTCCTCTGAATTGAAACGACCACTT
CTTTCCAGATGAAGTACGGATGCGGATTACTCAGGAATGGCACCACGGGC
GCTGTTATGGTCGGATTAGTTTGTGGCCTTTATGTTTGCAGCGGCCAATG
TGATAAGGTGGAAGTAATAGAGCTGAGCAATTGGACGATAACTAATCAGA
ATGGCTCCCTGACTATTGCCAACCAAACGTTGCCCTTGGGCATATACAGT
GCCTTCGCACCCCAAGTGCTGGACTCCTACAACGACGTCGGTCTGCGTTA
CTTGGCCTACGACAACTTTACCTTCTCCAATTTCTTTCAGTTCGACGTTC
ATCACTTCAATCGCGGCCACATCAACCTGACGTTTCACGGCATTGACACG
GTGTCGGAAATCCGGCTGAACCATCAACTGCTGGGACGCACGGACAACAT
GTTTGTCCGCTACTCTTACGAAGTGAGTTCCCTGCTCCAAGCGGAAAACT
TTCTGGAAGTTGAGATCCAATCTCCAGTTGTGGCTGCTTTGGCAAGAGCC
AATGCTTTAAAAGAAGCTAAAAAGAGCGTGCCTCCCGAATGCCCCAACGA
GCGCTACCATGGTGAGTGCCACATGAACATGCTGCGGAAGATGCAGGCTA
GCTTTTCCTGGGACTGGGGTCCTGCAGCTCCCTCTGCTGGAATCTGGAAA
AACGTGGAGCTGGAAATCTACGAGGTGGCGGTTATTCGTGAGGTGGATGT
GGACGTTAGCCGCGTCAATGGTTCGTACTGGAACATGCATATTCGCTGCT
TCCTGGACGCGGGAGGCTGGCAAAACTTCAATGGAAGACTCGTCCTATAT
GCTGTCGAGCTATTGGACCGTCCGGTAGTAGTAGACAGATACGCAATAAA
AAACATCAGTCACTTGGCGCCAGTAATTGAATTCGATCAGGCCGTGCCAA
ATGGGAAAGTCGTAACCTGGTGGCCCAATGGCTACGGCGAGCAGAAACTG
TATCCGCTCCACTTCACTCTGAAGACCTGGCTGGGACCTGATGGACCCGA
GGTTCGCTCTAAGACCAAGTCGCACAAGTCGCTCCGAGTGGGTTTTCGTA
CGCTTGATCTAGTAGAGGATCCCGCCCCTGACGGCGTTGGAAACACCTTC
CTGTTTCGAGTTAATGGTGTAGAAATGTTTATGAAAGGCAGTAACTACAT
ACCATCCCACTTATTACCCGAAATGCAAACAAATGAACAGATTTCACATT
TATTAAGGTCCGCCAAGGAAGCCCATATGAACATGCTTCGAGTCTGGGGA
GGCGGAGTTTACGAATCGGACTACTTTTACCAGCTCGCCGACAGCTTGGG
TCTTCTAATTTGGCAAGATATGATGTTTGCTTGTGCCATGTACCCGGTTA
ACGACGAATTCCTATCGTCAGTGCGTGAGGAGGTTCGCCAGAATGCCATG
CGACTATCACACCATCCAAGCGTAGCCATTTTTGTGACCAATAACGAAAA
CGAAGCTGCTTTGGTACAGAACTGGTACGGCACGCTTTTCGAAAGAGATC
GATTTGAGAGCGAGTACCGGGAGCTCTACCTTGCTAATGTCATCCACGAG
TTGAAGCTTGTTTCGCATAGCTCTCGACCTCAGCCACTGGTCTCCTCACC
TTCAAATGGCAAAGCTAGTGAACCGGACAACTATATTTCGAGCAACCCTC
AGGATAACCAAAATGGCGATGTACATTTCTACGACTACACTAAGGACGGC
TGGGATCCAGGAATTTTCCCACGTCCTCGATTCGTCAGTGAGTTCGGCTT
TCAGAGCTTTCCAGGCGCATACGCATGGCAGCGCAGCAAGGGCGAGGACG
ATGACCTCCTCGGCCTGATCACACACCGACAACACCACCCACTGGGAAAT
GTTCCTGTTATCGCACTAGTGGAGAGACACCTACCGCTGCCCTTTCCAGA
GAATGAGAACTACGCGACAGCACTGATTTACTTCAGCCAGATTGCTCAAG
CCATGGCCACAAAGGTGGAAACCGAATTATACCGTAGCCTTCGGGACACT
CCCCACAGAACGATGGGGGCCCTTTACTGGCAGCTGAATGATGTATGGGT
GGCGCCATCCTGGTCCAGCATTGATTTCTACGGCAACTGGAAGCTGCTCC
ATTACTGGGCACGTGATTTTCTAGCGCCTATTTCAATCGTTGCTCTTTAC
GAAAAGTCCACGGATTCGTTAAACATCTCCCTTATTTGTGACCAATTGGA
GGTGGACCCAAGGGAACTGAATGTCGTAGCTAACGTTCACCTGTGGTCCC
AGCTTCTGCCTCGGCAGTCCACCTCCTGGGATGTTACCCTGCGCCCCAAT
GGCGTGCAGTACGACAAGGTCATTGCCATCTCCGATCTGCTGCAAGGAGA
GTTCACCAGAACTAACGCGTTTTTGGAGCTGCAGTTGCGCCGCGGGCAGG
ATGTGATCTCTAGGACCCACTTCTTTCCCAGTAGCATTGCCGGAGCAGTC
GGAATAGAGGACCCCGGGCTTGAGTTCGAGATTGCCTCCCGTACCTGTCT
TAACACCACAAACGTCGTCCGCAACAGCGTCAGCATTAGCATACAGGTGA
AGCGCCCCGCCGTATTTGTATACCTAGAGCTGCTCAAGCCATACCGCTAC
ACCCTGTCCGAGAACGGATTTATGCAGACTGAGCCAATGCATGTCGTCTA
CCTAACGTTCGACGCACCCTTGTGCGCCCGCCTTTTGCGCAAGTCGGACC
TCCGTGTGCTGACCGTCAACGACTTTATGAGATAGTACGGAACGTCTTCA
TTGACAACTTTAAATCAACGTTTTATAAATAGCTTAACAATATACAATTC
AATAAATAGCAATTAGTGTTGAGCACCAAAAAAAAAAAAAAAAA

FI03673.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12582-RA 3025 CG12582-RA 91..3020 1..2930 14650 100 Plus
CG12582.e 3107 CG12582.e 429..3102 257..2930 13370 100 Plus
CG12582-RB 3173 CG12582-RB 495..3168 257..2930 13370 100 Plus
CG12582.e 3107 CG12582.e 65..320 1..256 1280 100 Plus
CG12582-RB 3173 CG12582-RB 65..320 1..256 1280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23981..24494 392..905 2570 100 Plus
chr3R 27901430 chr3R 27565..28044 1292..1771 2400 100 Plus
chr3R 27901430 chr3R 28097..28519 1771..2193 2115 100 Plus
chr3R 27901430 chr3R 29502..29884 2192..2574 1915 100 Plus
chr3R 27901430 chr3R 29933..30287 2573..2927 1775 100 Plus
chr3R 27901430 chr3R 24727..25015 1003..1291 1445 100 Plus
chr3R 27901430 chr3R 23029..23284 1..256 1280 100 Plus
chr3R 27901430 chr3R 23459..23593 257..391 675 100 Plus
chr3R 27901430 chr3R 24552..24649 906..1003 490 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG12582-RD 2727 CG12582-PD 1..2727 109..2835 13635 100 Plus
CG12582-RA 2727 CG12582-PA 1..2727 109..2835 13635 100 Plus
CG12582-RH 2721 CG12582-PH 1..2721 109..2835 13510 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:06 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG12582-RA 3035 CG12582-RA 102..3028 1..2927 14635 100 Plus
CG12582-RH 3029 CG12582-RH 102..3022 1..2927 14510 99.8 Plus
CG12582-RD 2922 CG12582-RD 97..2915 109..2927 14095 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG12582-PD 908 CG12582-PD 1..908 109..2832 4756 100 Plus
CG12582-PA 908 CG12582-PA 1..908 109..2832 4756 100 Plus
CG12582-PH 906 CG12582-PH 1..906 109..2832 4732 99.8 Plus
CG12582-PG 778 CG12582-PG 1..778 499..2832 4057 100 Plus
CG12582-PF 778 CG12582-PF 1..778 499..2832 4057 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4198259..4198772 392..905 2570 100 Plus
3R 32079331 3R 4201843..4202322 1292..1771 2400 100 Plus
3R 32079331 3R 4202375..4202797 1771..2193 2115 100 Plus
3R 32079331 3R 4203780..4204162 2192..2574 1915 100 Plus
3R 32079331 3R 4204211..4204568 2573..2930 1790 100 Plus
3R 32079331 3R 4199005..4199293 1003..1291 1445 100 Plus
3R 32079331 3R 4197307..4197562 1..256 1280 100 Plus
3R 32079331 3R 4197737..4197871 257..391 675 100 Plus
3R 32079331 3R 4198830..4198927 906..1003 490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 3939090..3939603 392..905 2570 100 Plus
3R 31820162 3R 3942674..3943153 1292..1771 2400 100 Plus
3R 31820162 3R 3943206..3943628 1771..2193 2115 100 Plus
3R 31820162 3R 3944611..3944993 2192..2574 1915 100 Plus
3R 31820162 3R 3945042..3945399 2573..2930 1790 100 Plus
3R 31820162 3R 3939836..3940124 1003..1291 1445 100 Plus
3R 31820162 3R 3938138..3938393 1..256 1280 100 Plus
3R 31820162 3R 3938568..3938702 257..391 675 100 Plus
3R 31820162 3R 3939661..3939758 906..1003 490 100 Plus
Blast to na_te.dros performed on 2014-11-27 09:31:16 has no hits.

FI03673.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:21:31 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 29935..30287 2575..2927 100   Plus
chr3R 29504..29884 2194..2574 100 -> Plus
chr3R 28098..28519 1772..2193 100 -> Plus
chr3R 27565..28044 1292..1771 100 -> Plus
chr3R 24727..25015 1003..1291 100 -> Plus
chr3R 24552..24648 906..1002 100 -> Plus
chr3R 23981..24494 392..905 100 -> Plus
chr3R 23459..23593 257..391 100 -> Plus
chr3R 23029..23284 1..256 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:45:32 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RA 1..2727 109..2835 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:09 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RA 1..2727 109..2835 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:37:29 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RA 1..2727 109..2835 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:24 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RA 1..2727 109..2835 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:21:31 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RA 1..2727 109..2835 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:49:38 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RA 1..2927 1..2927 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:09 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RA 1..2927 1..2927 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:37:29 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RA 102..3028 1..2927 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:28:28 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RA 1..2927 1..2927 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:21:31 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
CG12582-RA 102..3028 1..2927 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:21:31 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4204213..4204565 2575..2927 100   Plus
3R 4203782..4204162 2194..2574 100 -> Plus
3R 4202376..4202797 1772..2193 100 -> Plus
3R 4201843..4202322 1292..1771 100 -> Plus
3R 4199005..4199293 1003..1291 100 -> Plus
3R 4198830..4198926 906..1002 100 -> Plus
3R 4198259..4198772 392..905 100 -> Plus
3R 4197737..4197871 257..391 100 -> Plus
3R 4197307..4197562 1..256 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:37:29 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 29935..30287 2575..2927 100   Plus
arm_3R 29504..29884 2194..2574 100 -> Plus
arm_3R 28098..28519 1772..2193 100 -> Plus
arm_3R 27565..28044 1292..1771 100 -> Plus
arm_3R 24727..25015 1003..1291 100 -> Plus
arm_3R 24552..24648 906..1002 100 -> Plus
arm_3R 23981..24494 392..905 100 -> Plus
arm_3R 23459..23593 257..391 100 -> Plus
arm_3R 23029..23284 1..256 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:08 Download gff for FI03673.complete
Subject Subject Range Query Range Percent Splice Strand
3R 3945044..3945396 2575..2927 100   Plus
3R 3944613..3944993 2194..2574 100 -> Plus
3R 3943207..3943628 1772..2193 100 -> Plus
3R 3942674..3943153 1292..1771 100 -> Plus
3R 3939836..3940124 1003..1291 100 -> Plus
3R 3939661..3939757 906..1002 100 -> Plus
3R 3939090..3939603 392..905 100 -> Plus
3R 3938568..3938702 257..391 100 -> Plus
3R 3938138..3938393 1..256 100 -> Plus

FI03673.pep Sequence

Translation from 108 to 2834

> FI03673.pep
MKYGCGLLRNGTTGAVMVGLVCGLYVCSGQCDKVEVIELSNWTITNQNGS
LTIANQTLPLGIYSAFAPQVLDSYNDVGLRYLAYDNFTFSNFFQFDVHHF
NRGHINLTFHGIDTVSEIRLNHQLLGRTDNMFVRYSYEVSSLLQAENFLE
VEIQSPVVAALARANALKEAKKSVPPECPNERYHGECHMNMLRKMQASFS
WDWGPAAPSAGIWKNVELEIYEVAVIREVDVDVSRVNGSYWNMHIRCFLD
AGGWQNFNGRLVLYAVELLDRPVVVDRYAIKNISHLAPVIEFDQAVPNGK
VVTWWPNGYGEQKLYPLHFTLKTWLGPDGPEVRSKTKSHKSLRVGFRTLD
LVEDPAPDGVGNTFLFRVNGVEMFMKGSNYIPSHLLPEMQTNEQISHLLR
SAKEAHMNMLRVWGGGVYESDYFYQLADSLGLLIWQDMMFACAMYPVNDE
FLSSVREEVRQNAMRLSHHPSVAIFVTNNENEAALVQNWYGTLFERDRFE
SEYRELYLANVIHELKLVSHSSRPQPLVSSPSNGKASEPDNYISSNPQDN
QNGDVHFYDYTKDGWDPGIFPRPRFVSEFGFQSFPGAYAWQRSKGEDDDL
LGLITHRQHHPLGNVPVIALVERHLPLPFPENENYATALIYFSQIAQAMA
TKVETELYRSLRDTPHRTMGALYWQLNDVWVAPSWSSIDFYGNWKLLHYW
ARDFLAPISIVALYEKSTDSLNISLICDQLEVDPRELNVVANVHLWSQLL
PRQSTSWDVTLRPNGVQYDKVIAISDLLQGEFTRTNAFLELQLRRGQDVI
SRTHFFPSSIAGAVGIEDPGLEFEIASRTCLNTTNVVRNSVSISIQVKRP
AVFVYLELLKPYRYTLSENGFMQTEPMHVVYLTFDAPLCARLLRKSDLRV
LTVNDFMR*

FI03673.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17689-PA 908 GF17689-PA 5..907 8..907 3881 78.8 Plus
Dana\GF17688-PA 859 GF17688-PA 46..858 104..907 1693 42.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12176-PA 909 GG12176-PA 1..909 1..908 4532 92.4 Plus
Dere\GG12165-PA 907 GG12165-PA 1..906 17..907 1795 42.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18706-PA 913 GH18706-PA 3..912 5..907 3394 69.9 Plus
Dgri\GH18705-PA 855 GH18705-PA 41..855 103..908 1795 45 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG12582-PD 908 CG12582-PD 1..908 1..908 4833 100 Plus
CG12582-PA 908 CG12582-PA 1..908 1..908 4833 100 Plus
CG12582-PH 906 CG12582-PH 1..906 1..908 4809 99.8 Plus
CG12582-PG 778 CG12582-PG 1..778 131..908 4134 100 Plus
CG12582-PF 778 CG12582-PF 1..778 131..908 4134 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22853-PA 918 GI22853-PA 33..917 30..907 3426 70.4 Plus
Dmoj\GI22852-PA 909 GI22852-PA 4..908 17..907 1896 43 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12304-PA 912 GL12304-PA 1..879 1..877 3693 77.2 Plus
Dper\GL12303-PA 875 GL12303-PA 4..874 49..907 1820 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11702-PA 909 GA11702-PA 1..908 1..907 3779 77.3 Plus
Dpse\GA11702-PB 778 GA11702-PB 1..777 131..907 3322 79.2 Plus
Dpse\GA26271-PA 911 GA26271-PA 11..910 20..907 1861 42.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10734-PA 908 GM10734-PA 1..908 1..908 4649 95.5 Plus
Dsec\GM10733-PA 908 GM10733-PA 3..907 15..907 1853 44.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19705-PA 908 GD19705-PA 1..908 1..908 4648 95.5 Plus
Dsim\GD19704-PA 1141 GD19704-PA 266..1140 45..907 1809 44.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14154-PA 906 GJ14154-PA 25..904 30..908 3347 70.8 Plus
Dvir\GJ14153-PA 909 GJ14153-PA 5..908 16..907 1899 43.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12069-PA 915 GK12069-PA 1..914 1..907 3451 69.6 Plus
Dwil\GK12068-PA 906 GK12068-PA 23..905 34..907 1848 42.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25394-PA 908 GE25394-PA 1..908 1..908 4508 91.3 Plus
Dyak\GE18122-PA 88 GE18122-PA 1..32 1..32 152 81.2 Plus

FI03673.hyp Sequence

Translation from 108 to 2834

> FI03673.hyp
MKYGCGLLRNGTTGAVMVGLVCGLYVCSGQCDKVEVIELSNWTITNQNGS
LTIANQTLPLGIYSAFAPQVLDSYNDVGLRYLAYDNFTFSNFFQFDVHHF
NRGHINLTFHGIDTVSEIRLNHQLLGRTDNMFVRYSYEVSSLLQAENFLE
VEIQSPVVAALARANALKEAKKSVPPECPNERYHGECHMNMLRKMQASFS
WDWGPAAPSAGIWKNVELEIYEVAVIREVDVDVSRVNGSYWNMHIRCFLD
AGGWQNFNGRLVLYAVELLDRPVVVDRYAIKNISHLAPVIEFDQAVPNGK
VVTWWPNGYGEQKLYPLHFTLKTWLGPDGPEVRSKTKSHKSLRVGFRTLD
LVEDPAPDGVGNTFLFRVNGVEMFMKGSNYIPSHLLPEMQTNEQISHLLR
SAKEAHMNMLRVWGGGVYESDYFYQLADSLGLLIWQDMMFACAMYPVNDE
FLSSVREEVRQNAMRLSHHPSVAIFVTNNENEAALVQNWYGTLFERDRFE
SEYRELYLANVIHELKLVSHSSRPQPLVSSPSNGKASEPDNYISSNPQDN
QNGDVHFYDYTKDGWDPGIFPRPRFVSEFGFQSFPGAYAWQRSKGEDDDL
LGLITHRQHHPLGNVPVIALVERHLPLPFPENENYATALIYFSQIAQAMA
TKVETELYRSLRDTPHRTMGALYWQLNDVWVAPSWSSIDFYGNWKLLHYW
ARDFLAPISIVALYEKSTDSLNISLICDQLEVDPRELNVVANVHLWSQLL
PRQSTSWDVTLRPNGVQYDKVIAISDLLQGEFTRTNAFLELQLRRGQDVI
SRTHFFPSSIAGAVGIEDPGLEFEIASRTCLNTTNVVRNSVSISIQVKRP
AVFVYLELLKPYRYTLSENGFMQTEPMHVVYLTFDAPLCARLLRKSDLRV
LTVNDFMR*

FI03673.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG12582-PD 908 CG12582-PD 1..908 1..908 4833 100 Plus
CG12582-PA 908 CG12582-PA 1..908 1..908 4833 100 Plus
CG12582-PH 906 CG12582-PH 1..906 1..908 4809 99.8 Plus
CG12582-PG 778 CG12582-PG 1..778 131..908 4134 100 Plus
CG12582-PF 778 CG12582-PF 1..778 131..908 4134 100 Plus