Clone FI03674 Report

Search the DGRC for FI03674

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:74
Vector:pOT2
Associated Gene/TranscriptUgt-RA
Protein status:FI03674.pep: gold
Sequenced Size:5315

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Ugt 2008-08-15 Release 5.9 accounting
Ugt 2008-12-18 5.12 accounting

Clone Sequence Records

FI03674.complete Sequence

5315 bp assembled on 2008-07-17

GenBank Submission: BT044158.1

> FI03674.complete
CGGCATGCCGGTTCATCAACGAACGCCACATCAGTTCTAAATCAAATTAA
GAAAAACTGGGCTAAAACCAGCCGAAAACTGGTGAAAAGTAAAATATTTG
GAGAAGGAAAGCCTTAAGTTCCTCTCTACGCTTAGTATACGTAATGTGCG
TGGTTTAATCTACGTTAAAACAAGTGGAAACCATGTTACGTGCCGTGGCT
TTGTGTGTGTCTGTGGTGCTCATAGCACTATATACGCCAACTTCTGGGGA
ATCCAGTCAGAGCTATCCCATCACCACGCTAATCAACGCGAAATGGACGC
AGACGCCCCTATATCTGGAAATCGCCGAGTATCTGGCCGATGAGCAGGCG
GGCCTCTTCTGGGATTACGTTTCGGGGGTGACCAAGTTGGACACGGTTCT
CAACGAATATGATACCGAGTCGCAACAGTACAATGCCGCCTTGGAGCTGG
TCAAGAGCCATGTGAGTTCTCCCCAATTGCCCCTGCTTAGGCTGGTGGTA
TCCATGCATAGCTTGACGCCCCGGATCCAGACCCACTTCCAGTTGGCCGA
GGAACTGAGGAGCAGTGGCTCTTGTCAGAGCTTTACTTTTGCCCAGGTGG
GTTCCGAACTGGCCTGCAGCTTTAACGAGCTGCAGAAGAAGCTGGAAGTG
CCGCTCGCCAAGGATAGCTTGGATGCTTCTGTTGTCACCTACAGCTTTGA
TCACATTTTCCCTGGCAGTGAGAACAATACCCGCACTGTGGTACTATACG
GCGATTTGGGAAGCTCTCAATTCCGCACCTATCACAAACTATTGGAAAAG
GAAGCCAATGCTGGCCGGATTCGTTACATCTTGCGTCATCAATTGGCCAA
GAAGGACAAGCGACCGGTACGACTTTCGGGCTATGGAGTGGAACTCCATC
TGAAGTCAACGGAATACAAGAGTCAGGATGATGCTCCAAAGCCCGAAGCT
GGTTCCACTTCTGATGAGGATTTGGCTAATGAATCGGACGTCCAGGGCTT
TGATTTCAAGGTGCTGAAGCAGAAGCATCCTACACTTAAGAGAGCGCTGG
ATCAACTGCGTCAGAGGCTTCTTCAGGGAAACGATGAGATCGCCCAATTG
AAAGCATGGGAGTTCCAGGATTTGGGTCTCCAGGCGGCCGCTGCTATTGC
AGAAATACAGGGTGATGAAACCCTACAAATTCTTCAATATACTGCCCATA
ATTTCCCCATGTTGGCCAGAACCCTGCTGGCCCACAAGGTTACGGATGGC
TTAAGGGCGGAGGTAAAGCATAATACGGAAGCATTTGGAAGAAGCTTGAA
TGTAGCGCCTCCAGATGGTGCCCTTTTCATCAATGGACTCTTCTTCGATG
CTGACACAATGGATCTGTATTCCCTGATTGAGACGCTGCGCTCGGAGATG
CGTGTTCTCGAGAGTCTGCACAGTAATAATGTGAGGGGAAGCCTTGCCAG
CTCCTTGCTCGCCTTGGATCTGACGGCCTCCAGCAAAAAAGAATTCGCCA
TCGACATCCGTGACACTGCAGTACAGTGGGTCAACGATATTGAAAACGAT
GTGCAGTACCGCAGGTGGCCCTCATCGGTGATGGATCTTTTGCGTCCAAC
CTTTCCTGGCATGTTAAGGAATATCCGAAAGAATGTGTTCAATTTGGTCC
TAGTGGTAGACGCGCTGCAGCCCACAGCTAGAAGTGTTATTAAACTGTCA
GAGTCGTTTGTCATCCATCAAGCTCCCATTCGCTTGGGTTTGGTTTTCGA
TGCGAGGGACGCCAACGAGGATAATCTTGCAGATTACGTAGCCATCACGT
GCGCCTATAACTATGTGAGTCAGAAAAAGGATGCCCGAGCTGCTTTAAGT
TTCCTCACCGACATCTACGCAGCAGTTGGTGAGACCAAAGTGGTCACGAA
AAAAGACATAGTCAAGCAACTAACGAAGGAATTTACATCATTAAGCTTTG
CCAAAGCGGAGGAGTTCCTGGAGGAAGATTCCACGTACGACTATGGCAGG
GAGCTCGCAGCAGAGTTCATTCAGCGGCTGGGATTCGGAGACAAGGGACA
ACCTCAGGCCTTGTTGAATGGTGTTCCAATGCCCAGCAACGTTGTGACCG
CCGATAGCGACTTCGAGGAGGCTATTTTCACCGAGATTATGACCCACACC
AGCAATCTCCAAAAGGCTGTGTACAAAGGTGAACTGACAGACAACGATGT
AGCCATTGATTATCTGATGAATCAACCTCACGTGATGCCCAGATTGAATC
AGCGAATCCTAAGCCAGGAGGATGTGAAATATCTTGATATTAACGGCGTG
GCCTACAAAAATCTTGGCAATGTTGGAGTTTTAAATCGTCTGTCTAACCG
GGATATGACCGCTACGCTAATGGATAATCTTAAATACTTTGGTGGCAAGA
AGTCTACGGAGCTTATTGGCCGAGCATCCCTACAGTTCCTAACGATTTGG
GTGTTTGCTGATTTGGAAACTGACCAGGGTCGAGATCTGCTCACCCATGC
CCTGGACTATGTCCAAAGTGGAGAGAGTGTGCGAGTCGCATTCATTCCAA
ACACTGAAAGCTCTTCCGCCTCAAGCCGGAGGAATCTTAATCGATTGGTT
TGGGCTGCCATGCAGAGTCTTCCACCAACTCAAGCCACGGAGCAGGTTCT
CAAGTGGCTAAAGAAACCAAAGGAGAAAATTGAGATACCCACTCAGCTCG
AGGATATCCTGGGATCTACAGAGCTGCACCTGAAGATGTTGAGAGTTTAT
TCCCAGCGAGTGTTGGGTCTAAATAAATCCCAGCGTTTGGTCATCGGTAA
TGGGCGGCTTTATGGGCCCCTTTCGTCGGATGAAAGCTTTGATAGCGCCG
ATTTCGCTTTGCTAGCCAGGTTCAGTTCTCTACAGTATAGCGATAAGGTG
CGTCAGGTCCTGAAGGAATCTGCTCAAGATGTCAATGAGGAATTCAACAG
CGATACATTGCTTAAGTTGTATGCCAGCCTGCTTCCCAGGCAAACCAAAA
CTCGCTTTAAGCTACCAACGGACTTAAAAACCGATCACTCGGTTGTAAAA
CTACCGCCCAAACAGGAGAATCTTCCCCATTTTGATGTTGCCGCCGTTTT
GGATCCCGCCTCCCGAGCAGCTCAAAAACTAACGCCAATACTTATTTTGC
TTCGTCAAGTGCTGAACTGCCAATTGAACTTATACCTGATTCCCGTCCCC
CAGCACAGCGATATGCCCGTGAAGAACTTCTACAGATACGTTGTGGAACC
GGAGGTCCAATTCGAGGCGAATGGAGGCCGATCTGATGGTCCTTTGGCCA
AATTCAGTGGATTGCCAGCCAATCCTCTGCTGACCCAGCAGCTGCAGGTT
CCCGAGAACTGGTTGGTCGAAGCTGTGAGAGCAGTTTACGATCTGGACAA
CATTAAGTTGACCGATATTGGTGGACCTGTGCACAGCGAATTCGATCTGG
AGTATCTGCTGTTGGAGGGTCACTGCTTTGATGCTGCTAGCGGCGCTCCG
CCCAGAGGACTTCAGTTGGTGTTGGGTACCCAGAGTCAACCTACCTTGGT
AGATACTATTGTGATGGCGAATTTGGGTTATTTCCAACTTAAAGCCAATC
CAGGAGCTTGGTCCCTACGCTTGCGTGAAGGCAAATCGGCGGATATTTAT
GCAATCAGCCACATTGAAGGAACAAATACCCATCATTCGGCTGGCTCTTC
TGAAGTTCAGGTTCTTATAACCTCCTTGCGATCCCATGTTGTCAAATTAA
GGGTGTCTAAGAAGCCAGGCATGCAGCAGGCGGAACTCCTGTCAGATGAC
AACGAACAGGCAGCGCAATCAGGCATGTGGAACAGCATCGCCAGCAGTTT
TGGCGGCGGCAGTGCCAACCAAGCAGCCACTGATGAGGATACGGAAACCA
TCAACATTTTCTCTGTGGCATCGGGACACTTGTACGAACGTCTTCTAAGG
ATCATGATGGTTTCGCTGCTAAAGCACACAAAATCACCTGTGAAGTTCTG
GTTCTTGAAGAACTATCTTTCGCCGCAATTTACGGATTTCCTTCCTCACA
TGGCCAGTGAGTACAACTTCCAGTACGAATTGGTCCAGTACAAATGGCCC
CGCTGGCTGCATCAGCAAACGGAAAAACAGAGGACCATTTGGGGCTACAA
GATCCTTTTCCTGGACGTGCTCTTCCCGCTGAATGTGAGGAAAATCATTT
TCGTGGATGCCGATGCCATCGTAAGAACGGATATAAAGGAGTTGTATGAC
ATGGACCTCGGAGGAGCACCCTATGCCTACACGCCATTCTGCGATTCCCG
CAAAGAGATGGAGGGCTTCCGATTCTGGAAGCAGGGATACTGGCGAAGCC
ATCTGATGGGCAGGCGTTACCACATTTCCGCCTTGTACGTGGTGGACTTG
AAGAGATTCCGCAAGATTGCGGCAGGAGATAGGCTAAGAGGCCAATACCA
GGCACTTAGCCAGGATCCGAACAGCTTATCCAATTTGGATCAGGACTTGC
CCAACAACATGATCCACCAGGTCGCCATCAAATCCCTGCCCGACGACTGG
CTATGGTGCCAAACGTGGTGCAGCGACAGCAACTTCAAGACTGCTAAAGT
GATTGATTTGTGCAACAACCCGCAGACCAAGGAGGCCAAACTCACGGCCG
CCCAGAGGATTGTGCCCGAATGGAAGGACTACGATGCCGAGCTGAAGACC
CTGATGTCTCGCATCGAGGATCATGAGAATTCGCATAGCAGGGACTCGGC
AGTTGATGATTCGGTTGACGATTCGGTGGAGGTCACCACTGTGACGCCTT
CTCATGAGCCCAAGCACGGCGAGCTGTGATGAACGCGTAGTTAAATCAAC
ATGTTTAGTGAATTTAAATATCGATGGATAAACACTTGATTACTTAGCTA
AGAGCCATCTCCGAAATAACGACTAAACACATTTGTACATTTTAATTAGA
ACATAATGCGATTGATAACGTAAACCCAACTCAAAAAGAAAACAGCTCAC
TAAAGTCTGAATTGTGTTTTGTAACTCGATTTCGAACGATTTTCTTGTCT
TGCATTCCAAGAGCTACTAATTAAGTTAAGCCGAAATTAAATGTCATCAT
ACTAAATACGCGCCTTTAAGTTGAAGATTGTCAAATGTATTAAAAGTTGG
AGTAAATAGTAATTAATTCAGCGTATTTTATTAACCATTTATTTGGGATG
GTCAGGCCACTTTACCCCCTCGAAAAGCTTTGGTGACTGCGTATGTGCGT
TAGGTGGCAACGCCAAATTCAAATAAAGTTTTCAAAAATCTCAGTAAAAA
AAAAAAAAAAAAAAA

FI03674.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Ugt-RA 5351 Ugt-RA 50..5345 1..5296 26480 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18862970..18867854 411..5295 24185 99.7 Plus
chr3L 24539361 chr3L 18862377..18862787 1..411 2040 99.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Ugt-RA 4647 CG6850-PA 1..4647 183..4829 23235 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
Ugt-RA 5316 CG6850-RA 22..5316 1..5295 26475 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
Ugt-PA 1548 CG6850-PA 1..1548 183..4826 7523 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18873361..18878246 411..5296 24430 100 Plus
3L 28110227 3L 18872768..18873178 1..411 2055 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18866461..18871346 411..5296 24430 100 Plus
3L 28103327 3L 18865868..18866278 1..411 2055 100 Plus
Blast to na_te.dros performed on 2014-11-27 03:49:31 has no hits.

FI03674.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:41:53 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18862971..18867854 412..5295 99   Plus
chr3L 18862377..18862787 1..411 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:45:34 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 1..4647 183..4829 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:05 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 1..4647 183..4829 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:32 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 1..4647 183..4829 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:30 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 1..4647 183..4829 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:41:53 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 1..4647 183..4829 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:29:25 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 22..5316 1..5295 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:05 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 22..5316 1..5295 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:32 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 22..5316 1..5295 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:30 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 22..5316 1..5295 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:41:53 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
Ugt-RA 22..5316 1..5295 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:41:53 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18873362..18878245 412..5295 100   Plus
3L 18872768..18873178 1..411 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:32 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18866462..18871345 412..5295 100   Plus
arm_3L 18865868..18866278 1..411 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:58 Download gff for FI03674.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18866462..18871345 412..5295 100   Plus
3L 18865868..18866278 1..411 100 -> Plus

FI03674.pep Sequence

Translation from 182 to 4828

> FI03674.pep
MLRAVALCVSVVLIALYTPTSGESSQSYPITTLINAKWTQTPLYLEIAEY
LADEQAGLFWDYVSGVTKLDTVLNEYDTESQQYNAALELVKSHVSSPQLP
LLRLVVSMHSLTPRIQTHFQLAEELRSSGSCQSFTFAQVGSELACSFNEL
QKKLEVPLAKDSLDASVVTYSFDHIFPGSENNTRTVVLYGDLGSSQFRTY
HKLLEKEANAGRIRYILRHQLAKKDKRPVRLSGYGVELHLKSTEYKSQDD
APKPEAGSTSDEDLANESDVQGFDFKVLKQKHPTLKRALDQLRQRLLQGN
DEIAQLKAWEFQDLGLQAAAAIAEIQGDETLQILQYTAHNFPMLARTLLA
HKVTDGLRAEVKHNTEAFGRSLNVAPPDGALFINGLFFDADTMDLYSLIE
TLRSEMRVLESLHSNNVRGSLASSLLALDLTASSKKEFAIDIRDTAVQWV
NDIENDVQYRRWPSSVMDLLRPTFPGMLRNIRKNVFNLVLVVDALQPTAR
SVIKLSESFVIHQAPIRLGLVFDARDANEDNLADYVAITCAYNYVSQKKD
ARAALSFLTDIYAAVGETKVVTKKDIVKQLTKEFTSLSFAKAEEFLEEDS
TYDYGRELAAEFIQRLGFGDKGQPQALLNGVPMPSNVVTADSDFEEAIFT
EIMTHTSNLQKAVYKGELTDNDVAIDYLMNQPHVMPRLNQRILSQEDVKY
LDINGVAYKNLGNVGVLNRLSNRDMTATLMDNLKYFGGKKSTELIGRASL
QFLTIWVFADLETDQGRDLLTHALDYVQSGESVRVAFIPNTESSSASSRR
NLNRLVWAAMQSLPPTQATEQVLKWLKKPKEKIEIPTQLEDILGSTELHL
KMLRVYSQRVLGLNKSQRLVIGNGRLYGPLSSDESFDSADFALLARFSSL
QYSDKVRQVLKESAQDVNEEFNSDTLLKLYASLLPRQTKTRFKLPTDLKT
DHSVVKLPPKQENLPHFDVAAVLDPASRAAQKLTPILILLRQVLNCQLNL
YLIPVPQHSDMPVKNFYRYVVEPEVQFEANGGRSDGPLAKFSGLPANPLL
TQQLQVPENWLVEAVRAVYDLDNIKLTDIGGPVHSEFDLEYLLLEGHCFD
AASGAPPRGLQLVLGTQSQPTLVDTIVMANLGYFQLKANPGAWSLRLREG
KSADIYAISHIEGTNTHHSAGSSEVQVLITSLRSHVVKLRVSKKPGMQQA
ELLSDDNEQAAQSGMWNSIASSFGGGSANQAATDEDTETINIFSVASGHL
YERLLRIMMVSLLKHTKSPVKFWFLKNYLSPQFTDFLPHMASEYNFQYEL
VQYKWPRWLHQQTEKQRTIWGYKILFLDVLFPLNVRKIIFVDADAIVRTD
IKELYDMDLGGAPYAYTPFCDSRKEMEGFRFWKQGYWRSHLMGRRYHISA
LYVVDLKRFRKIAAGDRLRGQYQALSQDPNSLSNLDQDLPNNMIHQVAIK
SLPDDWLWCQTWCSDSNFKTAKVIDLCNNPQTKEAKLTAAQRIVPEWKDY
DAELKTLMSRIEDHENSHSRDSAVDDSVDDSVEVTTVTPSHEPKHGEL*

FI03674.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23647-PA 1551 GF23647-PA 1..1551 1..1548 7500 90.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16011-PA 1548 GG16011-PA 1..1548 1..1548 7934 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14599-PA 1558 GH14599-PA 21..1558 15..1548 6793 82.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
Ugt-PA 1548 CG6850-PA 1..1548 1..1548 7952 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:53:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13485-PA 1555 GI13485-PA 1..1555 1..1548 6775 82 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:53:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24887-PA 1081 GL24887-PA 1..1081 467..1548 5237 89.2 Plus
Dper\GL24886-PA 346 GL24886-PA 94..343 180..427 1148 88.8 Plus
Dper\GL24886-PA 346 GL24886-PA 1..87 1..88 344 80.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19904-PA 1546 GA19904-PA 1..1546 1..1548 7325 88.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15000-PA 1494 GM15000-PA 1..1494 1..1548 7655 94.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14778-PA 1531 GD14778-PA 1..1531 1..1548 7984 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:53:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11846-PA 1556 GJ11846-PA 1..1556 1..1548 6810 82.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20450-PA 1560 GK20450-PA 34..1560 28..1548 7170 87.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19572-PA 1548 GE19572-PA 1..1548 1..1548 7926 96.9 Plus
Dyak\GE23184-PA 421 GE23184-PA 1..421 1128..1548 2174 96.4 Plus
Dyak\GE23183-PA 80 GE23183-PA 1..76 1..76 393 98.7 Plus

FI03674.hyp Sequence

Translation from 182 to 4828

> FI03674.hyp
MLRAVALCVSVVLIALYTPTSGESSQSYPITTLINAKWTQTPLYLEIAEY
LADEQAGLFWDYVSGVTKLDTVLNEYDTESQQYNAALELVKSHVSSPQLP
LLRLVVSMHSLTPRIQTHFQLAEELRSSGSCQSFTFAQVGSELACSFNEL
QKKLEVPLAKDSLDASVVTYSFDHIFPGSENNTRTVVLYGDLGSSQFRTY
HKLLEKEANAGRIRYILRHQLAKKDKRPVRLSGYGVELHLKSTEYKSQDD
APKPEAGSTSDEDLANESDVQGFDFKVLKQKHPTLKRALDQLRQRLLQGN
DEIAQLKAWEFQDLGLQAAAAIAEIQGDETLQILQYTAHNFPMLARTLLA
HKVTDGLRAEVKHNTEAFGRSLNVAPPDGALFINGLFFDADTMDLYSLIE
TLRSEMRVLESLHSNNVRGSLASSLLALDLTASSKKEFAIDIRDTAVQWV
NDIENDVQYRRWPSSVMDLLRPTFPGMLRNIRKNVFNLVLVVDALQPTAR
SVIKLSESFVIHQAPIRLGLVFDARDANEDNLADYVAITCAYNYVSQKKD
ARAALSFLTDIYAAVGETKVVTKKDIVKQLTKEFTSLSFAKAEEFLEEDS
TYDYGRELAAEFIQRLGFGDKGQPQALLNGVPMPSNVVTADSDFEEAIFT
EIMTHTSNLQKAVYKGELTDNDVAIDYLMNQPHVMPRLNQRILSQEDVKY
LDINGVAYKNLGNVGVLNRLSNRDMTATLMDNLKYFGGKKSTELIGRASL
QFLTIWVFADLETDQGRDLLTHALDYVQSGESVRVAFIPNTESSSASSRR
NLNRLVWAAMQSLPPTQATEQVLKWLKKPKEKIEIPTQLEDILGSTELHL
KMLRVYSQRVLGLNKSQRLVIGNGRLYGPLSSDESFDSADFALLARFSSL
QYSDKVRQVLKESAQDVNEEFNSDTLLKLYASLLPRQTKTRFKLPTDLKT
DHSVVKLPPKQENLPHFDVAAVLDPASRAAQKLTPILILLRQVLNCQLNL
YLIPVPQHSDMPVKNFYRYVVEPEVQFEANGGRSDGPLAKFSGLPANPLL
TQQLQVPENWLVEAVRAVYDLDNIKLTDIGGPVHSEFDLEYLLLEGHCFD
AASGAPPRGLQLVLGTQSQPTLVDTIVMANLGYFQLKANPGAWSLRLREG
KSADIYAISHIEGTNTHHSAGSSEVQVLITSLRSHVVKLRVSKKPGMQQA
ELLSDDNEQAAQSGMWNSIASSFGGGSANQAATDEDTETINIFSVASGHL
YERLLRIMMVSLLKHTKSPVKFWFLKNYLSPQFTDFLPHMASEYNFQYEL
VQYKWPRWLHQQTEKQRTIWGYKILFLDVLFPLNVRKIIFVDADAIVRTD
IKELYDMDLGGAPYAYTPFCDSRKEMEGFRFWKQGYWRSHLMGRRYHISA
LYVVDLKRFRKIAAGDRLRGQYQALSQDPNSLSNLDQDLPNNMIHQVAIK
SLPDDWLWCQTWCSDSNFKTAKVIDLCNNPQTKEAKLTAAQRIVPEWKDY
DAELKTLMSRIEDHENSHSRDSAVDDSVDDSVEVTTVTPSHEPKHGEL*

FI03674.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Ugt-PA 1548 CG6850-PA 1..1548 1..1548 7952 100 Plus