Clone FI03680 Report

Search the DGRC for FI03680

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:80
Vector:pOT2
Associated Gene/TranscriptCG8128-RA
Protein status:FI03680.pep: gold
Sequenced Size:1532

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8128 2008-08-15 Release 5.9 accounting
CG8128 2008-12-18 5.12 accounting

Clone Sequence Records

FI03680.complete Sequence

1532 bp assembled on 2008-08-11

GenBank Submission: BT044161.1

> FI03680.complete
TAGTGGAAGTGGAAGCGAATTGAAATCGCGCGCTGCTCTATTCGCTTGTT
TATGCCAAAGTCCATGGCTACATTGGATCGGATCTGTAATTAGTCGTCTG
GAGGAACTGGACGGATTGGCTCAGTGACACCATTAGCCATTGACTTTTCT
ACATGCCCAGGAATTGGCTTCACCTCGCATTGTGGATAAACTGAGACGGT
AAAGTCGTTGTCGCCGCCACCGCCTCCGCCACGCCCACCAAGCGGACAGC
ACCCAGATCTCCGGTTGCGAACTAGTAGTGACGCCAACGTGGTCGATCGC
CGTCGTCGTCATCAACAACGTTGTGTTCGTCGAACTGTGAGATTATTTAA
TGTTGGCCACCGGTTTTCTGGCTCGCAGAACCGTACTTAACCAGCCGGCG
TTCAATTCATGGAGCACACTCCTCCGGACCGCTAGAAAACGACCCACATC
CACGGTTGCCGCCAGAGTTCCATTAAAGCTTCAGTCACAGCAGCAATTTA
CAAGAGCATACTCGTCCTCCAAAACCATGGACACGCCGGCGGATGTATTC
CGCGGCATTACGGATCGATTTGCCGGAGTAACAGTCGATGGGCGCGAGGA
GAACGTGGACAAATCCAGTTTCCGGGACAAGCTCACAAAATCCCTGGACT
TTTGGACGACGAACAAGAACCGGGCCATTTGGTTCCGCGTGTACAAGGAG
CAGGCTGATTGGGTGCCCATTCTGGCGGAGAACGGCTTTGATTTCCATCA
TGCCAAGACCGGTGTGGTGGTCATGTACCGCTGGTTGCCGGAGCACGAGT
CTAGCAACCTACCCACCTACGCCCACACGCTAATGGGCGTCGGCGGACTG
GTTATCAACGAACAGGACGAGGTGCTGGTGGTGTCCGATCGTTTTGCAAT
GATACCAAACAGCTGGAAGCTGCCCGGCGGCTATGTGGAGCCGCGGGAGA
ATCTCATCGATGCGGCAATACGAGAGGTGGCCGAGGAGACGGGAATCCGC
ACCGAATTCCGCTCAGTGGTCAGTCTGCGGCATGCCCATGGCGGCACCTT
CGGCTGCTCCGACATGTACGTGGTCATCGCCCTAAAGCCACTGAATTTGG
ACTTTACGCGCTGCGAACGCGAGATAGCGCGCATCCAGTGGATGCCCATC
GCGGAGTATCTGAAGCATCCGCAGGTCCACGAGACGAACAGGCAGTTCGT
CTGCACCTTTTTGGACTACCAGAAGCGCGGCCTGACCCTCACCTGTCGCG
ACGAAGTGCATCAGGTGCTAAAGAAGAAATACAATCTGTATTACGTGGAT
CGGGAGCAGCCACAGGAGCAGCAGGATAAAAAGAATTCGTGAGACTTGTC
GGTGCAATGGCCAAATCCTTAGTGCAATTTTTATAAAGTCCTTTCTTCCA
AAAGCCAGCAGCATCACAACTGCGCATTCAAATGTTCACAATGTAGTCAA
TAAATGAATTTTTTTGTATATAATTATATGCATATATCAATTAAAGCTCA
CACAGCCTTTTAAAAAAAAAAAAAAAAAAAAA

FI03680.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8128-RA 1685 CG8128-RA 124..1640 1..1517 7570 99.9 Plus
CG8128.a 1815 CG8128.a 450..1815 152..1517 6815 99.9 Plus
CG8128.a 1815 CG8128.a 9..159 1..151 755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15588979..15589851 639..1511 4335 99.8 Plus
chrX 22417052 chrX 15588140..15588504 152..516 1810 99.7 Plus
chrX 22417052 chrX 15587328..15587478 1..151 755 100 Plus
chrX 22417052 chrX 15588577..15588698 517..638 610 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG8128-RB 993 CG8128-PB 1..993 350..1342 4965 100 Plus
CG8128-RA 993 CG8128-PA 1..993 350..1342 4965 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:14 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG8128-RA 1530 CG8128-RA 20..1530 1..1511 7555 100 Plus
CG8128-RB 1809 CG8128-RB 450..1809 152..1511 6800 100 Plus
CG8128-RB 1809 CG8128-RB 9..159 1..151 755 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG8128-PB 330 CG8128-PB 1..330 350..1339 1742 100 Plus
CG8128-PA 330 CG8128-PA 1..330 350..1339 1742 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15699162..15700040 639..1517 4380 99.9 Plus
X 23542271 X 15698323..15698687 152..516 1825 100 Plus
X 23542271 X 15697513..15697663 1..151 755 100 Plus
X 23542271 X 15698760..15698881 517..638 610 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15707260..15708138 639..1517 4380 99.8 Plus
X 23527363 X 15706421..15706785 152..516 1825 100 Plus
X 23527363 X 15705611..15705761 1..151 755 100 Plus
X 23527363 X 15706858..15706979 517..638 610 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:47:52 has no hits.

FI03680.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:38:28 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15588979..15589851 639..1511 99   Plus
chrX 15588577..15588698 517..638 100 -> Plus
chrX 15588140..15588504 152..516 99 -> Plus
chrX 15587328..15587478 1..151 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:45:44 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 1..993 350..1342 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:12 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 1..993 350..1342 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:37:11 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 1..993 350..1342 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:25 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 1..993 350..1342 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:38:28 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 1..993 350..1342 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:49:42 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 9..1519 1..1511 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:12 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 9..1519 1..1511 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:37:11 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 20..1530 1..1511 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:28:40 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 9..1519 1..1511 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:38:28 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
CG8128-RA 20..1530 1..1511 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:38:28 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
X 15699162..15700034 639..1511 100   Plus
X 15698760..15698881 517..638 100 -> Plus
X 15698323..15698687 152..516 100 -> Plus
X 15697513..15697663 1..151 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:37:11 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15593195..15594067 639..1511 100   Plus
arm_X 15592793..15592914 517..638 100 -> Plus
arm_X 15592356..15592720 152..516 100 -> Plus
arm_X 15591546..15591696 1..151 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:11 Download gff for FI03680.complete
Subject Subject Range Query Range Percent Splice Strand
X 15707260..15708132 639..1511 100   Plus
X 15706858..15706979 517..638 100 -> Plus
X 15706421..15706785 152..516 100 -> Plus
X 15705611..15705761 1..151 100 -> Plus

FI03680.pep Sequence

Translation from 349 to 1341

> FI03680.pep
MLATGFLARRTVLNQPAFNSWSTLLRTARKRPTSTVAARVPLKLQSQQQF
TRAYSSSKTMDTPADVFRGITDRFAGVTVDGREENVDKSSFRDKLTKSLD
FWTTNKNRAIWFRVYKEQADWVPILAENGFDFHHAKTGVVVMYRWLPEHE
SSNLPTYAHTLMGVGGLVINEQDEVLVVSDRFAMIPNSWKLPGGYVEPRE
NLIDAAIREVAEETGIRTEFRSVVSLRHAHGGTFGCSDMYVVIALKPLNL
DFTRCEREIARIQWMPIAEYLKHPQVHETNRQFVCTFLDYQKRGLTLTCR
DEVHQVLKKKYNLYYVDREQPQEQQDKKNS*

FI03680.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21920-PA 328 GF21920-PA 1..324 1..320 1286 72.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17898-PA 326 GG17898-PA 1..325 1..329 1626 90.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17882-PA 273 GH17882-PA 1..272 60..328 1023 67.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG8128-PB 330 CG8128-PB 1..330 1..330 1742 100 Plus
CG8128-PA 330 CG8128-PA 1..330 1..330 1742 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16454-PA 271 GI16454-PA 1..270 60..328 1023 67.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16479-PA 331 GL16479-PA 1..320 1..317 1326 76.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22601-PA 331 GA22601-PA 1..320 1..317 1331 76.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22565-PA 326 GM22565-PA 1..326 1..330 1724 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17228-PA 326 GD17228-PA 1..326 1..330 1728 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15854-PA 295 GJ15854-PA 23..295 57..328 1065 69.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17180-PA 338 GK17180-PA 1..338 1..326 1218 66 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17206-PA 329 GE17206-PA 1..328 1..329 1662 95.1 Plus

FI03680.hyp Sequence

Translation from 349 to 1341

> FI03680.hyp
MLATGFLARRTVLNQPAFNSWSTLLRTARKRPTSTVAARVPLKLQSQQQF
TRAYSSSKTMDTPADVFRGITDRFAGVTVDGREENVDKSSFRDKLTKSLD
FWTTNKNRAIWFRVYKEQADWVPILAENGFDFHHAKTGVVVMYRWLPEHE
SSNLPTYAHTLMGVGGLVINEQDEVLVVSDRFAMIPNSWKLPGGYVEPRE
NLIDAAIREVAEETGIRTEFRSVVSLRHAHGGTFGCSDMYVVIALKPLNL
DFTRCEREIARIQWMPIAEYLKHPQVHETNRQFVCTFLDYQKRGLTLTCR
DEVHQVLKKKYNLYYVDREQPQEQQDKKNS*

FI03680.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG8128-PB 330 CG8128-PB 1..330 1..330 1742 100 Plus
CG8128-PA 330 CG8128-PA 1..330 1..330 1742 100 Plus