Clone FI03684 Report

Search the DGRC for FI03684

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:84
Vector:pOT2
Associated Gene/TranscriptCG10512-RA
Protein status:FI03684.pep: gold
Sequenced Size:2032

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10512 2008-12-18 5.12 accounting

Clone Sequence Records

FI03684.complete Sequence

2032 bp assembled on 2008-10-23

GenBank Submission: BT044163.1

> FI03684.complete
CCAGCTCAGCTGATTCTGATTGGGATTCTTACTACTCTCTCTCTCTCTCT
CTGTCTCTCTTCATTACGATACGTAATATACGTATACGTATTTGTATACC
CCTCTCTCTCACACACTCTTCTATTCTGTTTTGGTTACCTTTTTGTGGGT
TACGTTACCTTATTTGCCGATATGACTGCTTTGACATTGCTACGACGATC
AGTTACGGCGGTCAGCTACGACGGTTACGCCCACGTTTGCGTTACGAATT
GGCGGTTTCTGCCCCAGCTTCAAAGGTGCCAATTGCATTTGCACGTTAGT
GGGCGACATGCTGCTGTACTTTTGTCCAGCAAAACAACAGCAACAACAGC
AACATCAGCTGTTGCAGCTGCGCAGGCGCCAAATGCGTATGCTAATGTTG
GCGGCTTTTCCATCACGTACCGCACCATGTCCGCCGCTGCTCCGAAACTG
GTGGCCGTTGCCGAGTCGCGTCGTTTCATGATCGACTGCTTCAAGGCGGT
GAAGGTGCCCCAGGCCCATGCCGAAGCCCAGGCGGATCTCCTGGTGGCTG
CGGACCATCGGGGGCACTTCAGCCATGGCATGAACCGCCTTGAGATGTAC
ATCAACGATCTGGCCATCAACTCCACGGACGGAGCGGCTGTGCCCAAGAT
CCTAAAGGAAACTCCGGCCACCGCCTGGGTGGATGGCCTGAATGGACTTG
GTGCCGTCGTGGGCAACTACTGCATGGATCTGGCCATCAAGAAGGCCAAG
ACGGTGGGAGTTGGCTGGGTTTGTGCCAAGGGATCGAACCACTATGGCAT
GGCTGGTTGGTATGCCATCAGGGCCATGGATCAGGGTCTGGTGGGCATGT
CCATGACGAATACCTCGCCGCTGATGGCACCCACACGCGCCAAGGAGGCT
GCTCTGGGCACCAATCCCTTGTCCCTGGGTGCCAATGCCACCAACGGTGA
TAAGTTCCTGCTGGACATGGCCACCACAGCCGTGGCCGTGGGAAAGATCG
AGATCCAGCGCAGGAAGGGAGCTCCTCTGCCCGACGGATGGGCTCAGGAT
CCCAGTGGTGAAGTGACCAACGATGCAGAGCTGGGTTTCAGCACTGGGTG
CCTGATGCCATTAGGAGGATCCGAGCTGACCTCCGGCTACAAGGGTTACG
GCCTTGGCGCCATGGTGGACATTCTGTCGGGTGTCATGTCCGGAGCCAAC
TACTCGACGCAGGTGAGGAAGTGGACACATGCTGGCGCCGATTCCGCAGC
TGATCTTGGCCAGGTCTTCATCGCCGTGGATCCCAACTGCTTTGCTCCCA
ACTTCGAGGAACGCATGGCCGACTTCAACTCCCGCCTGCGAGGCGCTACT
CCGACCGATCCCAGCAAGCCCGTTTTGCTGGCTGGAGACAAGGAGAAGAA
GGGAATGGCTGACGTCGATGCCGCCGGCGGTATACAGTATCTGGAGAATC
AGTTGAAGACGTGCGCCAACCTGGCGGAAATACTGAAGATTAAGCCCCTG
AGCTTTGTTTAAACTCGAAAGAACTGGTGGACTTACACTAGGGAGTCAAG
CATACCCATTGCCATATGTTGAAGACGCCTCTGCATTTTGATGGACCAAA
GCACTACAGTAACACTTTACACTGAGAGAAATATTGATATTTGCAACAGT
TAGATTAGATTGCACTGGTGCTGAACTAAAGCTAGTTACATATCTCCATG
TTGCACTTAAAACATATTTCTAGTCTCCTGAGAGTCTGTCGTTGCTCCTA
TTATTTAGTTTTTAACTACGCAAGCTTTCTTATTAACTAAAAACATGAGC
TTCGGCATTCTTTTGGGGAATTAGCAATATTTAGTAGAGTAAAGACTTGC
AGTTTGCAAAATAATATACATAAGTAGAAGTACAGCTAAATTTCTGTTTA
AAACAAAAACTATCTGTTTTAAAATATATTGATTTTGGCACTTTGAGATA
CCCATGCTGTGTTCAGCAATTTCAAAACTATTAAAATAAACAATATACTC
TTCGATAATCAAAAAAAAAAAAAAAAAAAAAA

FI03684.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG10512-RA 2128 CG10512-RA 113..2125 1..2013 10035 99.9 Plus
CG10512-RC 1760 CG10512-RC 147..1757 403..2013 8025 99.8 Plus
CG10512-RB 1846 CG10512-RB 237..1846 403..2012 8020 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21194681..21195631 403..1353 4755 100 Plus
chr3L 24539361 chr3L 21196440..21197097 1353..2010 3260 99.7 Plus
chr3L 24539361 chr3L 21191925..21192328 1..404 2020 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG10512-RA 1341 CG10512-PA 1..1341 172..1512 6705 100 Plus
CG10512-RB 1146 CG10512-PB 37..1146 403..1512 5550 100 Plus
CG10512-RD 1086 CG10512-PD 1..1086 427..1512 5430 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG10512-RA 2010 CG10512-RA 1..2010 1..2010 10020 99.9 Plus
CG10512-RD 1659 CG10512-RD 52..1659 403..2010 8010 99.9 Plus
CG10512-RC 1704 CG10512-RC 97..1704 403..2010 8010 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG10512-PA 446 CG10512-PA 1..446 172..1509 2141 100 Plus
CG10512-PB 381 CG10512-PB 13..381 403..1509 1916 100 Plus
CG10512-PD 361 CG10512-PD 1..361 427..1509 1874 100 Plus
CG10512-PC 361 CG10512-PC 1..361 427..1509 1874 100 Plus
CG18808-PA 385 CG18808-PA 25..372 424..1500 625 38.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21205676..21206626 403..1353 4755 100 Plus
3L 28110227 3L 21207435..21208095 1353..2013 3275 99.7 Plus
3L 28110227 3L 21202920..21203323 1..404 2020 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21198776..21199726 403..1353 4755 100 Plus
3L 28103327 3L 21200535..21201195 1353..2013 3275 99.6 Plus
3L 28103327 3L 21196020..21196423 1..404 2020 100 Plus
Blast to na_te.dros performed 2014-11-27 05:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2363 327..375 141 80.4 Plus
X-element 4740 X-element ROXELEMENT 4740bp 1747..1784 332..369 127 81.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2388..2421 327..359 122 88.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6818 327..368 122 79.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2329..2372 333..375 118 77.3 Plus
roo 9092 roo DM_ROO 9092bp 1130..1164 327..360 118 85.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2386..2421 333..368 117 80.6 Plus
roo 9092 roo DM_ROO 9092bp 1113..1148 333..368 117 80.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6770 326..371 114 76 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6784 327..375 114 74.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6805 327..375 114 74.5 Plus

FI03684.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:29:53 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21196441..21197097 1354..2010 99   Plus
chr3L 21194682..21195631 404..1353 100 -> Plus
chr3L 21191925..21192327 1..403 93 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:45:50 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 1..1341 172..1512 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:00:27 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 1..1341 172..1512 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:22:03 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 1..1341 172..1512 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:30 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 1..1341 172..1512 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:29:53 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 1..1341 172..1512 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:17:51 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 1..2010 1..2010 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:00:26 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 1..2010 1..2010 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:22:03 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 1..2010 1..2010 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-23 18:44:22 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 1..2010 1..2010 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:29:53 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
CG10512-RA 1..2010 1..2010 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:29:53 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21207436..21208092 1354..2010 99   Plus
3L 21205677..21206626 404..1353 100 -> Plus
3L 21202920..21203322 1..403 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:22:03 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21200536..21201192 1354..2010 99   Plus
arm_3L 21198777..21199726 404..1353 100 -> Plus
arm_3L 21196020..21196422 1..403 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:27:27 Download gff for FI03684.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21200536..21201192 1354..2010 99   Plus
3L 21198777..21199726 404..1353 100 -> Plus
3L 21196020..21196422 1..403 100 -> Plus

FI03684.pep Sequence

Translation from 0 to 1511

> FI03684.pep
PAQLILIGILTTLSLSLCLSSLRYVIYVYVFVYPSLSHTLLFCFGYLFVG
YVTLFADMTALTLLRRSVTAVSYDGYAHVCVTNWRFLPQLQRCQLHLHVS
GRHAAVLLSSKTTATTATSAVAAAQAPNAYANVGGFSITYRTMSAAAPKL
VAVAESRRFMIDCFKAVKVPQAHAEAQADLLVAADHRGHFSHGMNRLEMY
INDLAINSTDGAAVPKILKETPATAWVDGLNGLGAVVGNYCMDLAIKKAK
TVGVGWVCAKGSNHYGMAGWYAIRAMDQGLVGMSMTNTSPLMAPTRAKEA
ALGTNPLSLGANATNGDKFLLDMATTAVAVGKIEIQRRKGAPLPDGWAQD
PSGEVTNDAELGFSTGCLMPLGGSELTSGYKGYGLGAMVDILSGVMSGAN
YSTQVRKWTHAGADSAADLGQVFIAVDPNCFAPNFEERMADFNSRLRGAT
PTDPSKPVLLAGDKEKKGMADVDAAGGIQYLENQLKTCANLAEILKIKPL
SFV*

FI03684.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24300-PA 440 GF24300-PA 1..439 58..503 1753 76.9 Plus
Dana\GF24712-PA 398 GF24712-PA 46..387 150..502 644 38.6 Plus
Dana\GF17333-PA 492 GF17333-PA 117..469 147..502 635 39.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16165-PA 449 GG16165-PA 1..449 58..503 2077 89.8 Plus
Dere\GG14160-PA 385 GG14160-PA 33..374 150..502 652 39.4 Plus
Dere\GG15586-PA 469 GG15586-PA 89..452 134..502 644 38.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14969-PA 436 GH14969-PA 1..435 58..502 1743 77.3 Plus
Dgri\GH12133-PA 362 GH12133-PA 3..361 144..502 1696 88 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG10512-PA 446 CG10512-PA 1..446 58..503 2308 100 Plus
CG10512-PB 381 CG10512-PB 13..381 135..503 1916 100 Plus
CG10512-PD 361 CG10512-PD 1..361 143..503 1874 100 Plus
CG10512-PC 361 CG10512-PC 1..361 143..503 1874 100 Plus
CG18808-PA 385 CG18808-PA 25..372 142..500 625 38.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13129-PA 433 GI13129-PA 52..433 122..503 1641 80.4 Plus
Dmoj\GI12569-PA 399 GI12569-PA 41..387 150..502 657 40.1 Plus
Dmoj\GI10050-PA 450 GI10050-PA 96..445 150..502 595 38.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24667-PA 361 GL24667-PA 1..360 143..502 1803 92.8 Plus
Dper\GL17929-PA 384 GL17929-PA 15..379 119..502 706 38.7 Plus
Dper\GL12513-PA 468 GL12513-PA 115..465 149..502 669 42 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10363-PA 440 GA10363-PA 1..439 58..502 1826 80.7 Plus
Dpse\GA15088-PA 384 GA15088-PA 21..378 125..501 705 39 Plus
Dpse\GA14384-PA 468 GA14384-PA 115..465 149..502 663 41.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22347-PA 446 GM22347-PA 1..446 58..503 2192 96.4 Plus
Dsec\GM13948-PA 385 GM13948-PA 33..374 150..502 650 39.1 Plus
Dsec\GM23206-PA 461 GM23206-PA 84..447 134..502 642 38.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17648-PA 286 GD17648-PA 13..249 135..371 1252 99.2 Plus
Dsim\GD13232-PA 385 GD13232-PA 33..374 150..502 654 39.4 Plus
Dsim\GD20077-PA 455 GD20077-PA 84..447 134..502 641 38.7 Plus
Dsim\GD14940-PA 84 GD14940-PA 33..84 452..503 251 92.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13877-PA 363 GJ13877-PA 2..362 142..502 1671 85 Plus
Dvir\GJ15473-PA 400 GJ15473-PA 42..388 150..502 741 43.2 Plus
Dvir\GJ23783-PA 520 GJ23783-PA 166..514 150..501 660 40.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16815-PA 362 GK16815-PA 3..361 144..502 1799 93.3 Plus
Dwil\GK19287-PA 388 GK19287-PA 26..375 146..502 730 41.7 Plus
Dwil\GK22789-PA 502 GK22789-PA 132..494 140..501 638 40.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23055-PA 440 GE23055-PA 1..440 58..503 2190 93.3 Plus
Dyak\GE19733-PA 440 GE19733-PA 1..440 58..503 2152 93.5 Plus
Dyak\GE20586-PA 385 GE20586-PA 33..374 150..502 650 39.4 Plus
Dyak\GE11137-PA 460 GE11137-PA 108..457 150..502 638 39.3 Plus

FI03684.hyp Sequence

Translation from 0 to 1511

> FI03684.hyp
PAQLILIGILTTLSLSLCLSSLRYVIYVYVFVYPSLSHTLLFCFGYLFVG
YVTLFADMTALTLLRRSVTAVSYDGYAHVCVTNWRFLPQLQRCQLHLHVS
GRHAAVLLSSKTTATTATSAVAAAQAPNAYANVGGFSITYRTMSAAAPKL
VAVAESRRFMIDCFKAVKVPQAHAEAQADLLVAADHRGHFSHGMNRLEMY
INDLAINSTDGAAVPKILKETPATAWVDGLNGLGAVVGNYCMDLAIKKAK
TVGVGWVCAKGSNHYGMAGWYAIRAMDQGLVGMSMTNTSPLMAPTRAKEA
ALGTNPLSLGANATNGDKFLLDMATTAVAVGKIEIQRRKGAPLPDGWAQD
PSGEVTNDAELGFSTGCLMPLGGSELTSGYKGYGLGAMVDILSGVMSGAN
YSTQVRKWTHAGADSAADLGQVFIAVDPNCFAPNFEERMADFNSRLRGAT
PTDPSKPVLLAGDKEKKGMADVDAAGGIQYLENQLKTCANLAEILKIKPL
SFV*

FI03684.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG10512-PA 446 CG10512-PA 1..446 58..503 2308 100 Plus
CG10512-PB 381 CG10512-PB 13..381 135..503 1916 100 Plus
CG10512-PD 361 CG10512-PD 1..361 143..503 1874 100 Plus
CG10512-PC 361 CG10512-PC 1..361 143..503 1874 100 Plus
CG18808-PA 385 CG18808-PA 25..372 142..500 625 38.8 Plus