Clone FI03688 Report

Search the DGRC for FI03688

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:88
Vector:pOT2
Associated Gene/TranscriptPrm-RA
Protein status:FI03688.pep: gold
Sequenced Size:3250

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Prm 2008-08-15 Release 5.9 accounting
Prm 2008-12-18 5.12 accounting

Clone Sequence Records

FI03688.complete Sequence

3250 bp assembled on 2008-07-17

GenBank Submission: BT044164.1

> FI03688.complete
ACGAAATACTCTTTATTCGAACGACAACGGGATCTCTTGTTCAGTAGATC
ACCAGCCTTACTCCGACGTTTATTACGAATTTTCTCGGTGACTCGGTGAC
AACTACAAAACTGCGTGCGGTGCTGTATAGATTTTCGCTTGAGAGGAACA
CACAAATCATAATACTAGATACGCGAACCGATCGCACATTAATTTATAGA
ACCAAAATCGAAAATCTGACCTAGCAAACATGTCGTCATCGCAGGCTGTC
CGCTCCTCGAAATACTCCTACCGTGCCACGTCCACCGGACCCGGTACCGC
CGATGTGAACATCGAGTACATCCAGGACCTGAGCTCGCTCTCCCGCTTGG
AGGACAAGATCCGTTTGCTCCAAGATGATCTTGAAGTTGAACGTGAGTTG
CGCCAAAGGATCGAGCGCGAGAAAGCCGATCTCAGCGTTCAGGTCATTCA
GATGTCCGAGCGTCTCGAGGAGGCCGAGGGTGGTGCTGAACATCAATTTG
AAGCCAACCGCAAGCGCGACGCTGAGCTGCTGAAGCTGCGCAAGCTGCTT
GAGGATGTTCATCTTGAGTCGGAGGAGACCACTTTGCTTTTGAAGAAAAA
GCACAACGAAATTATCACGGATTTCCAGGAACAGGTTGAAATCCTAACGA
AAAACAAGGCCAGAGCCGAAAAGGACAAGGCCAAATTCCAGACCGAAGTC
TACGAGCTGCTCTCCCAGATCGAGTCCTACAACAAGGAGAAGATCGTGTC
GGAGAAGCACATCTCCAAACTGGAGGTCTCGATCTCCGAGCTCAACGTGA
AGATCGAGGAGCTTAACCGCACCGTTATCGACATTAGCTCCCACCGATCC
CGCCTCTCGCAGGAGAACATTGAGCTGACCAAGGACGTCCAAGATCTGAA
GGTTCAGCTGGACACGGTCTCGTTCTCCAAGAGCCAGGTCATTTCCCAGC
TGGAGGACGCCCGCCGTCGCTTGGAGGACGAGGACCGTCGTCGCTCGCTG
CTCGAATCCTCTCTGCATCAGGTTGAGATCGAATTGGACTCGGTTCGTAA
TCAACTCGAGGAGGAGTCCGAGGCCCGCATCGACTTGGAACGTCAGTTGG
TCAAGGCCAATGCCGATGCCACCTCCTGGCAGAACAAGTGGAACTCCGAG
GTGGCTGCCCGCGCCGAGGAGGTCGAGGAGATCCGTCGCAAGTACCAGGT
CCGCATCACCGAGCTGGAGGAGCACATCGAGTCCCTCATCGTCAAGGTCA
ACAATCTGGAGAAGATGAAGACGCGCCTGGCCAGCGAAGTGGAGGTGCTC
ATCATCGATCTGGAGAAGTCGAACAACAGCTGCCGCGAGCTGACCAAGTC
GGTCAACACCCTCGAGAAGCACAACGTTGAGCTGAAGAGCCGTCTGGACG
AGACCATCATCCTGTACGAGACCAGCCAGCGCGACCTGAAGAACAAGCAC
GCCGACCTCGTCCGCACTGTCCACGAACTGGACAAGGTCAAGGACAACAA
CAACCAGCTGACCCGCGAGAACAAGAAACTGGGAGATGATCTTCATGAGG
CCAAGGGTGCCATCAACGAACTGAACCGTCGTCTGCACGAATTGGAACTG
GAGCTGCGTCGTCTGGAGAACGAGCGTGATGAGCTGACCGCTGCCTACAA
GGAAGCCGAGGCTGGCCGCAAGGCTGAGGAGCAGCGCGGACAGCGCCTGG
CCGCCGACTTCAACCAGTACCGCCACGACGCCGAGCGTCGTCTGGCCGAG
AAGGATGAGGAGATCGAGGCCATTCGCAAGCAGACCTCGATCGAGATCGA
GCAGCTCAATGCCCGCGTCATCGAGGCGGAGACCCGGCTGAAGACCGAGG
TGACCCGCATCAAGAAGAAGCTGCAGATCCAGATCACCGAGCTGGAGATG
TCGCTGGATGTGGCCAACAAGACCAACATCGATCTGCAGAAGGTGATCAA
GAAGCAGTCGCTGCAGCTGACCGAACTGCAGGCCCACTACGAGGATGTCC
AGCGCCAGTTGCAGGCCACCTTGGACCAGTATGCCGTTGCCCAGCGCCGT
CTGGCCGGTCTCAATGGCGAGCTGGAGGAGGTGCGCTCGCACCTGGACAG
CGCCAACCGTGCCAAGCGCACCGTGGAGCTGCAGTACGAGGAGGCTGCCT
CCCGCATCAACGAACTGACCACCGCCAATGTCAGCCTCGTCTCCATCAAG
TCCAAGCTGGAGCAGGAGCTCTCCGTGGTCGCCTCCGACTACGAGGAGGT
GTCCAAGGAGCTGCGCATCAGCGACGAGCGCTACCAGAAGGTCCAGGTGG
AGCTCAAGCATGTCGTCGAGCAGGTGCATGAGGAGCAGGAGCGCATCGTT
AAGCTGGAGACCATCAAGAAGTCCTTGGAAGTCGAAGTCAAGAACTTGTC
CATCCGCTTGGAGGAGGTCGAGCTGAACGCCGTCGCCGGCAGCAAGCGCA
TCATCAGCAAGCTGGAAGCCCGCATCCGCGATCTGGAGCTGGAGCTGGAG
GAGGAGAAGCGCCGCCACGCCGAGACCATCAAGATTCTGCGCAAGAAGGA
GCGCACCGTCAAGGAGGTGCTGGTGCAGTGCGAGGAGGACCAGAAGAACC
TCATCCTGCTGCAGGACGCGCTGGACAAGTCCACTGCCAAGATCAACATC
TACCGCCGCCAGCTGTCCGAGCAGGAGGGTGTCTCCCAGCAGACCACCAC
CCGTGTGCGCCGCTTCCAGCGCGAGCTGGAGGCTGCCGAGGATCGCGCCG
ACACCGCCGAGTCCAGCCTGAACATCATCCGCGCCAAGCACCGCACATTC
GTCACCACCTCGACGGTGCCCGGATCCCAGGTGTACATCCAGGAGACCAC
AAGGACGATCACCGAATAGAGCCCCACGCTCCGCACCGAGATCATTTCAT
TATCAAACGCTAACCGAAGAACCGAACACAACCAATCCCGAACCCATGAA
GAAGACCATCTGGCGGAGGGCAGAGTTCAGAGTGCAGGACGAGAACGAGA
ATTGCGTGAGAAAGTTTTTATAATTTAAATTTTTTTGTCAAACCCCCAAA
ACGCCGCGGCAGCGATTAGAACCCAGTGGACTTCGGCGGGGGCTCGTATA
GGCTACACACTATAAATACATAACACTACACATCCTATCTATATAATAAT
AATACTATTTTGAAGTTCATGTAATTTAATTAAAATAATGAACCTGAAAA
ACCTAAAAACAAAATAAAAACAAACCAACGAAAAAAAAAAAAAAAAAAAA

FI03688.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Prm-RB 3362 Prm-RB 103..3336 1..3234 16170 100 Plus
Prm.b 3856 Prm.b 103..3336 1..3234 16170 100 Plus
Prm-RA 3856 Prm-RA 103..3336 1..3234 16170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8731622..8732496 1535..661 4360 99.9 Minus
chr3L 24539361 chr3L 8725338..8726178 3230..2391 4140 99.8 Minus
chr3L 24539361 chr3L 8726287..8726903 2392..1776 3085 100 Minus
chr3L 24539361 chr3L 8736986..8737338 353..1 1765 100 Minus
chr3L 24539361 chr3L 8734148..8734314 663..497 835 100 Minus
chr3L 24539361 chr3L 8731413..8731543 1664..1534 640 99.2 Minus
chr3L 24539361 chr3L 8731217..8731329 1776..1664 565 100 Minus
chr3L 24539361 chr3L 8734379..8734466 496..409 440 100 Minus
chr3L 24539361 chr3L 8736299..8736362 409..346 305 98.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:17:27
Subject Length Description Subject Range Query Range Score Percent Strand
Prm-RA 2640 CG5939-PA 1..2640 230..2869 13200 100 Plus
Prm-RB 2640 CG5939-PB 1..2640 230..2869 13200 100 Plus
Prm-RD 1923 CG5939-PD 830..1923 1776..2869 5470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
Prm-RA 3661 CG5939-RA 1..3226 5..3230 16130 100 Plus
Prm-RB 3226 CG5939-RB 1..3226 5..3230 16130 100 Plus
Prm-RD 2720 CG5939-RD 1266..2720 1776..3230 7275 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
Prm-PA 879 CG5939-PA 1..879 230..2866 3538 100 Plus
Prm-PB 879 CG5939-PB 1..879 230..2866 3538 100 Plus
Prm-PD 640 CG5939-PD 256..640 1724..2866 1431 95.1 Plus
Prm-PC 640 CG5939-PC 256..640 1724..2866 1431 95.1 Plus
Mhc-PU 1949 CG17927-PU 1095..1924 302..2794 1129 38.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8739580..8740454 1535..661 4375 100 Minus
3L 28110227 3L 8733289..8734132 3234..2391 4220 100 Minus
3L 28110227 3L 8734240..8734856 2392..1776 3085 100 Minus
3L 28110227 3L 8744962..8745314 353..1 1765 100 Minus
3L 28110227 3L 8742106..8742272 663..497 835 100 Minus
3L 28110227 3L 8739366..8739496 1664..1534 655 100 Minus
3L 28110227 3L 8739170..8739282 1776..1664 565 100 Minus
3L 28110227 3L 8742337..8742424 496..409 440 100 Minus
3L 28110227 3L 8744275..8744338 409..346 305 98.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8732680..8733554 1535..661 4375 100 Minus
3L 28103327 3L 8726389..8727232 3234..2391 4220 100 Minus
3L 28103327 3L 8727340..8727956 2392..1776 3085 100 Minus
3L 28103327 3L 8738062..8738414 353..1 1765 100 Minus
3L 28103327 3L 8735206..8735372 663..497 835 100 Minus
3L 28103327 3L 8732466..8732596 1664..1534 655 100 Minus
3L 28103327 3L 8732270..8732382 1776..1664 565 100 Minus
3L 28103327 3L 8735437..8735524 496..409 440 100 Minus
3L 28103327 3L 8737375..8737438 409..346 305 98.4 Minus
Blast to na_te.dros performed 2014-11-26 21:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1128..1244 3223..3105 166 62.2 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1111..1230 3223..3107 160 62.8 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1083..1198 3223..3107 148 65 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1075..1177 3219..3115 141 61.9 Minus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1097..1212 3223..3105 119 60.3 Minus

FI03688.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:29:33 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8736987..8737338 1..352 100   Minus
chr3L 8736299..8736355 353..409 100 <- Minus
chr3L 8734379..8734465 410..496 100 <- Minus
chr3L 8734148..8734314 497..663 100 <- Minus
chr3L 8731622..8732493 664..1535 99 <- Minus
chr3L 8731414..8731541 1536..1663 99 <- Minus
chr3L 8731217..8731329 1664..1776 100 <- Minus
chr3L 8726287..8726902 1777..2392 100 <- Minus
chr3L 8725364..8726176 2393..3204 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:51:38 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RA 1..2640 230..2869 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:24 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RA 1..2640 230..2869 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:48:44 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RB 1..2640 230..2869 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:49 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RA 1..2640 230..2869 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:29:33 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RB 1..2640 230..2869 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:51:30 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RA 34..3237 1..3204 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:24 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RA 34..3237 1..3204 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:48:44 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RB 1..3200 5..3204 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:49 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RA 34..3237 1..3204 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:29:33 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
Prm-RB 1..3200 5..3204 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:29:33 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8744963..8745314 1..352 100   Minus
3L 8744275..8744331 353..409 100 <- Minus
3L 8742337..8742423 410..496 100 <- Minus
3L 8742106..8742272 497..663 100 <- Minus
3L 8739580..8740451 664..1535 100 <- Minus
3L 8739367..8739494 1536..1663 100 <- Minus
3L 8739170..8739282 1664..1776 100 <- Minus
3L 8734240..8734855 1777..2392 100 <- Minus
3L 8733319..8734130 2393..3204 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:48:44 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8738063..8738414 1..352 100   Minus
arm_3L 8737375..8737431 353..409 100 <- Minus
arm_3L 8735437..8735523 410..496 100 <- Minus
arm_3L 8735206..8735372 497..663 100 <- Minus
arm_3L 8732680..8733551 664..1535 100 <- Minus
arm_3L 8732467..8732594 1536..1663 100 <- Minus
arm_3L 8732270..8732382 1664..1776 100 <- Minus
arm_3L 8727340..8727955 1777..2392 100 <- Minus
arm_3L 8726419..8727230 2393..3204 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:23 Download gff for FI03688.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8738063..8738414 1..352 100   Minus
3L 8737375..8737431 353..409 100 <- Minus
3L 8735437..8735523 410..496 100 <- Minus
3L 8735206..8735372 497..663 100 <- Minus
3L 8732680..8733551 664..1535 100 <- Minus
3L 8732467..8732594 1536..1663 100 <- Minus
3L 8732270..8732382 1664..1776 100 <- Minus
3L 8727340..8727955 1777..2392 100 <- Minus
3L 8726419..8727230 2393..3204 100 <- Minus

FI03688.pep Sequence

Translation from 229 to 2868

> FI03688.pep
MSSSQAVRSSKYSYRATSTGPGTADVNIEYIQDLSSLSRLEDKIRLLQDD
LEVERELRQRIEREKADLSVQVIQMSERLEEAEGGAEHQFEANRKRDAEL
LKLRKLLEDVHLESEETTLLLKKKHNEIITDFQEQVEILTKNKARAEKDK
AKFQTEVYELLSQIESYNKEKIVSEKHISKLEVSISELNVKIEELNRTVI
DISSHRSRLSQENIELTKDVQDLKVQLDTVSFSKSQVISQLEDARRRLED
EDRRRSLLESSLHQVEIELDSVRNQLEEESEARIDLERQLVKANADATSW
QNKWNSEVAARAEEVEEIRRKYQVRITELEEHIESLIVKVNNLEKMKTRL
ASEVEVLIIDLEKSNNSCRELTKSVNTLEKHNVELKSRLDETIILYETSQ
RDLKNKHADLVRTVHELDKVKDNNNQLTRENKKLGDDLHEAKGAINELNR
RLHELELELRRLENERDELTAAYKEAEAGRKAEEQRGQRLAADFNQYRHD
AERRLAEKDEEIEAIRKQTSIEIEQLNARVIEAETRLKTEVTRIKKKLQI
QITELEMSLDVANKTNIDLQKVIKKQSLQLTELQAHYEDVQRQLQATLDQ
YAVAQRRLAGLNGELEEVRSHLDSANRAKRTVELQYEEAASRINELTTAN
VSLVSIKSKLEQELSVVASDYEEVSKELRISDERYQKVQVELKHVVEQVH
EEQERIVKLETIKKSLEVEVKNLSIRLEEVELNAVAGSKRIISKLEARIR
DLELELEEEKRRHAETIKILRKKERTVKEVLVQCEEDQKNLILLQDALDK
STAKINIYRRQLSEQEGVSQQTTTRVRRFQRELEAAEDRADTAESSLNII
RAKHRTFVTTSTVPGSQVYIQETTRTITE*

FI03688.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10148-PA 879 GF10148-PA 1..879 1..879 4144 96.6 Plus
Dana\GF15360-PA 2165 GF15360-PA 1328..2128 55..856 1104 38.4 Plus
Dana\GF11513-PA 2013 GF11513-PA 1209..1967 95..855 412 27.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15062-PA 879 GG15062-PA 1..879 1..879 4407 99.3 Plus
Dere\GG22771-PA 2156 GG22771-PA 1319..2119 55..856 1104 38.4 Plus
Dere\GG19865-PA 2012 GG19865-PA 1209..1967 95..855 422 27.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16141-PA 879 GH16141-PA 1..879 1..879 4043 93.9 Plus
Dgri\GH11564-PA 2153 GH11564-PA 1316..2116 55..856 1102 38.5 Plus
Dgri\GH18000-PA 188 GH18000-PA 2..180 543..721 822 91.6 Plus
Dgri\GH22039-PA 2021 GH22039-PA 1161..1953 40..834 424 27.3 Plus
Dgri\GH22510-PA 70 GH22510-PA 1..60 1..60 284 91.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Prm-PA 879 CG5939-PA 1..879 1..879 4268 100 Plus
Prm-PB 879 CG5939-PB 1..879 1..879 4268 100 Plus
Prm-PD 640 CG5939-PD 256..640 499..879 1740 95.1 Plus
Prm-PC 640 CG5939-PC 256..640 499..879 1740 95.1 Plus
Mhc-PU 1949 CG17927-PU 1095..1924 25..855 1515 38.1 Plus
Prm-PD 640 CG5939-PD 125..620 145..655 230 21.3 Plus
Prm-PC 640 CG5939-PC 125..620 145..655 230 21.3 Plus
Prm-PD 640 CG5939-PD 208..621 7..413 173 22.1 Plus
Prm-PC 640 CG5939-PC 208..621 7..413 173 22.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12410-PA 879 GI12410-PA 1..879 1..879 3953 94.4 Plus
Dmoj\GI17055-PA 2153 GI17055-PA 1316..2116 55..856 1102 38.4 Plus
Dmoj\GI19126-PA 2047 GI19126-PA 1187..1979 40..834 439 27.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10286-PA 637 GL10286-PA 275..637 517..879 1698 94.8 Plus
Dper\GL10285-PA 439 GL10285-PA 1..439 1..516 1444 69.2 Plus
Dper\GL18785-PA 1283 GL18785-PA 873..1257 180..565 499 37.6 Plus
Dper\GL10886-PA 2045 GL10886-PA 1238..1996 95..855 414 27.6 Plus
Dper\GL18355-PA 141 GL18355-PA 1..129 737..864 219 46.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 14:00:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19246-PB 879 GA19246-PB 1..879 1..879 3998 95.3 Plus
Dpse\GA19246-PC 637 GA19246-PC 275..637 517..879 1698 94.8 Plus
Dpse\GA25794-PA 2166 GA25794-PA 1329..2129 55..856 1100 38.3 Plus
Dpse\GA13959-PA 2014 GA13959-PA 1207..1965 95..855 415 27.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 14:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17204-PA 2153 GM17204-PA 1316..2129 55..868 1106 38.2 Plus
Dsec\GM24918-PA 340 GM24918-PA 184..340 723..879 693 93 Plus
Dsec\GM24918-PA 340 GM24918-PA 1..148 1..148 686 98 Plus
Dsec\GM11766-PA 1557 GM11766-PA 1232..1516 95..380 218 29.7 Plus
Dsec\GM11767-PA 405 GM11767-PA 37..340 531..834 171 26.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 14:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12965-PA 644 GD12965-PA 1..625 1..625 2930 99.7 Plus
Dsim\GD13296-PA 240 GD13296-PA 3..240 603..846 1073 92.2 Plus
Dsim\GD24081-PA 749 GD24081-PA 3..725 146..868 982 37.6 Plus
Dsim\GD24899-PA 1771 GD24899-PA 1270..1727 397..855 217 26.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 14:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Prm-PA 879 GJ12302-PA 1..879 1..879 4001 94.2 Plus
Dvir\Mhc-PA 2153 GJ17305-PA 1316..2116 55..856 1104 38.4 Plus
Dvir\GJ22258-PA 2035 GJ22258-PA 1177..1969 40..834 428 27.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 14:00:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17471-PA 879 GK17471-PA 1..879 1..879 4032 96.4 Plus
Dwil\GK18232-PA 2147 GK18232-PA 1310..2110 55..856 1081 38.9 Plus
Dwil\GK20720-PA 2015 GK20720-PA 1212..1949 95..834 413 28.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 14:00:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21285-PA 879 GE21285-PA 1..879 1..879 4414 99.5 Plus
Dyak\Mhc-PA 2153 GE12765-PA 1316..2116 55..856 1101 38.4 Plus
Dyak\GE11388-PA 2011 GE11388-PA 1209..1967 95..855 428 27.4 Plus

FI03688.hyp Sequence

Translation from 229 to 2868

> FI03688.hyp
MSSSQAVRSSKYSYRATSTGPGTADVNIEYIQDLSSLSRLEDKIRLLQDD
LEVERELRQRIEREKADLSVQVIQMSERLEEAEGGAEHQFEANRKRDAEL
LKLRKLLEDVHLESEETTLLLKKKHNEIITDFQEQVEILTKNKARAEKDK
AKFQTEVYELLSQIESYNKEKIVSEKHISKLEVSISELNVKIEELNRTVI
DISSHRSRLSQENIELTKDVQDLKVQLDTVSFSKSQVISQLEDARRRLED
EDRRRSLLESSLHQVEIELDSVRNQLEEESEARIDLERQLVKANADATSW
QNKWNSEVAARAEEVEEIRRKYQVRITELEEHIESLIVKVNNLEKMKTRL
ASEVEVLIIDLEKSNNSCRELTKSVNTLEKHNVELKSRLDETIILYETSQ
RDLKNKHADLVRTVHELDKVKDNNNQLTRENKKLGDDLHEAKGAINELNR
RLHELELELRRLENERDELTAAYKEAEAGRKAEEQRGQRLAADFNQYRHD
AERRLAEKDEEIEAIRKQTSIEIEQLNARVIEAETRLKTEVTRIKKKLQI
QITELEMSLDVANKTNIDLQKVIKKQSLQLTELQAHYEDVQRQLQATLDQ
YAVAQRRLAGLNGELEEVRSHLDSANRAKRTVELQYEEAASRINELTTAN
VSLVSIKSKLEQELSVVASDYEEVSKELRISDERYQKVQVELKHVVEQVH
EEQERIVKLETIKKSLEVEVKNLSIRLEEVELNAVAGSKRIISKLEARIR
DLELELEEEKRRHAETIKILRKKERTVKEVLVQCEEDQKNLILLQDALDK
STAKINIYRRQLSEQEGVSQQTTTRVRRFQRELEAAEDRADTAESSLNII
RAKHRTFVTTSTVPGSQVYIQETTRTITE*

FI03688.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Prm-PA 879 CG5939-PA 1..879 1..879 4268 100 Plus
Prm-PB 879 CG5939-PB 1..879 1..879 4268 100 Plus
Prm-PD 640 CG5939-PD 256..640 499..879 1740 95.1 Plus
Prm-PC 640 CG5939-PC 256..640 499..879 1740 95.1 Plus
Mhc-PU 1949 CG17927-PU 1095..1924 25..855 1515 38.1 Plus
Prm-PD 640 CG5939-PD 125..620 145..655 230 21.3 Plus
Prm-PC 640 CG5939-PC 125..620 145..655 230 21.3 Plus
Prm-PD 640 CG5939-PD 208..621 7..413 173 22.1 Plus
Prm-PC 640 CG5939-PC 208..621 7..413 173 22.1 Plus