Clone FI03690 Report

Search the DGRC for FI03690

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:36
Well:90
Vector:pOT2
Associated Gene/TranscriptGk-RA
Protein status:FI03690.pep: gold
Sequenced Size:2323

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7995 2008-12-18 5.12 accounting

Clone Sequence Records

FI03690.complete Sequence

2323 bp assembled on 2008-08-15

GenBank Submission: BT044165.1

> FI03690.complete
CTCGACGTGGTCGGTTGTGTTTTGCTCGTCGCGCTCTGTCCTGCTCATTC
GATCGATTTGCTGCCTCTCTTTCGTCGCGAACTGTCGCCTCTTTGGGATT
TGAAAATATTTAAACAAGTGTTATCAGCGGCCATAAACAACAATCGAATA
CAAAAAGCAGCATGACCGAGGGCAAGAACTTACCCCACTCTAGTGCGGAT
GTGCCGTTCCGCAGCAAGGAGCTGCGCAAGCAATCGCTCATCCAGCACAC
CGGCCTGGTCGGAGTCATCGATGAGGGCACCAAGACCATCGGTTTCTCCA
TCTACACCACGCCGGACTTCAAGGAGATCGCCGCACACCGGGTGGAGCTG
AGCGTGATCACGCCCCAGGATGGCTGGTATGAGCAGGATCCGCTGGAGAT
GATGGCCTCGATCAACAAGTGCGCCGAGGAGGCCATCAAGCAGCTACCCG
AACAGGGTTTCTCTGCCAGCGACATTGTCACCGTGGGCATAACCAACCAG
CGCGAGACGACAATCGTCTGGGATGCGGTCACCGGCAAACCGCTGTACAA
TGCGCTCCTGTGGAAGGACATCCGCACTAGCACTACAGTGGAGCAGATCG
TGGCCAAGGTGCAGGATCCGAACCACTTCCGCAGCAGCACTGGCCTGCCC
ATCTCCACGTACTTCTCGGCCCTCAAGATCCGCTGGCTGCGGGACAATGT
GCCCGAGGTGCGACAGGCCATCCGGGAAAGGCGATGCAAGGCGGGCACAG
TCGACAGCTGGATCGTCTGGAACTTGACAAACGGAGCTCTCCACATCACG
GATGTAACGAATGCCTCCCGCACTCTGCTCATGAATCTGGAGACGCAAGC
CTGGGATCCTGTTCTGCTCAAGACGTTCGGTATCAGAGAGGAGATGCTGC
CCACCATCCACAGCTGTTCGGAGATATTTGGCAAGATCACTTCGGAGCGA
AGTCCACTGCGTGGGATGACCCTAAGTGGAATAATGGGCAACCAGCAGGC
CTCGCTTCTGGGCCAGATGTGCGTGAAGCCGGGTCAAACGAAGAACACCT
ACCGATCCGGCTGTTTTCTGCTCTGCAATACGGGGGACAAGCCGGTCTTT
TCCAGGCACGGTCTGCTCACCACCGTGGCTTACAAACTCGGTCCCCAGGC
ACCGACGATTTACGCAATTGAGGGAGCTGTGTCGGTGGCCGGACATGCGC
TGTCCTGGCTGCAAAACAAGGTGCGTATCCTGCCGGACTCCAGAGATGCC
GAGAAATATGCGGAGATGGTGCCCACATCGGGGGATGTGTACTTCGTGCC
CGCCTTTACAGGACTATATGCTCCCTACTGGCGGCAGAATGCTCGCGGCA
TCATCATTGGGCTCACGCAGTTCACCCGTAAGAATCACATAGTGAGAGCT
GCACTGGAGAGCATCTGCTTCCAGACGCGCGACATCCTAGAGTGCATGCA
TCAGGAGTGCGGTTACGAAATCAATAAGCTTCATGCTGATGGCAAGCTCA
CCACGAACAACCTGTTGATGCAACTCCAGGCGGACACCATTGGCATGCCC
GTCTTCCGCTCCCAGCTAATGGACTCCACCGCTTTCGGGGCAGCCATGTG
CGCCGCCCAGGCAGATGGTGTCAATCTCTGCCAGTTCGAGCCTGAGAAGC
GATACTACGAGAACGTGCACTACGACACCTTCCTGGCCACCACCACGGAT
GTAGAGCGAAAGGAGCGATACGGCAAGTGGAAGCGGGCGGTGGAGCGCAG
TTTGGGATGGGTCATCAAGCAGAAGAAGACGCGTGAGTACACGGAGGAGA
ACTACCGCATGCTGTCCTCTCTGCCAGCGAGCATCTTCCTCATCAGCAGC
TTCGCCATGCTGGTGCATTCCCTCGCTGCGAGTGGCCAGTAAATACGACA
GTCGCCTGACACTTAGATCGATTCTAGGTTGTGATAATAATTATTTGTCC
GGATTTCGTTTGGATCTTATACACACACTCTGTACATAGTCCTCGAAGGA
CAGTGGGTGGTTGAACGTGCTTTAAACCCTGTAAATAGCTGGACTAAGCT
CCGTACTACTTTAAGTATCCCGTATCCTGACTATCTTAACGTGTTTTCGT
TGCATATTCTGTACGTCTTAGCCGTAGTTCCATTGACGTTGGCTGGACTT
CCGCGCGCCACGCAGGCCCATATCAGCGGAATTGTATATAGCCAAAGTGC
AAACGACATTTCTAATTTAAGTAGGTCCCGTACTCGTATGTGTATGTATA
TGTATGTAGTGATTACGCCCCTTAAACAATAAACAGATATAATACGAATC
GAAAAAAAAAAAAAAAAAAAAAA

FI03690.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG7995.e 2651 CG7995.e 16..2319 1..2304 11520 100 Plus
CG7995-RA 2489 CG7995-RA 16..2319 1..2304 11520 100 Plus
CG7995.c 2321 CG7995.c 16..2315 1..2304 11435 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1743463..1744981 783..2301 7595 100 Plus
chr3L 24539361 chr3L 1742768..1743395 157..784 3140 100 Plus
chr3L 24539361 chr3L 1741415..1741571 1..157 785 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
Gk-RF 1731 CG7995-PF 1..1731 162..1892 8655 100 Plus
Gk-RA 1731 CG7995-PA 1..1731 162..1892 8655 100 Plus
Gk-RB 1731 CG7995-PB 1..1731 162..1892 8655 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:19 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Gk-RA 2318 CG7995-RA 18..2318 1..2301 11505 100 Plus
Gk-RF 2483 CG7995-RF 339..2483 157..2301 10725 100 Plus
Gk-RB 2251 CG7995-RB 107..2251 157..2301 10725 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
Gk-PF 576 CG7995-PF 1..576 162..1889 3010 100 Plus
Gk-PA 576 CG7995-PA 1..576 162..1889 3010 100 Plus
Gk-PB 576 CG7995-PB 1..576 162..1889 3010 100 Plus
Gk-PD 576 CG7995-PD 1..576 162..1889 3010 100 Plus
Gk-PE 576 CG7995-PE 1..576 162..1889 3010 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1743903..1745424 783..2304 7610 100 Plus
3L 28110227 3L 1743208..1743835 157..784 3140 100 Plus
3L 28110227 3L 1741855..1742011 1..157 785 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1743903..1745424 783..2304 7610 100 Plus
3L 28103327 3L 1743208..1743835 157..784 3140 100 Plus
3L 28103327 3L 1741855..1742011 1..157 785 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:06:50 has no hits.

FI03690.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:44:08 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1743464..1744981 784..2301 100   Plus
chr3L 1742768..1743394 157..783 100 -> Plus
chr3L 1741415..1741570 1..156 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:45:56 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
CG7995-RD 1..1731 162..1892 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:22 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
CG7995-RD 1..1731 162..1892 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:38:28 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
Gk-RD 1..1731 162..1892 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:31 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
CG7995-RC 1..1731 162..1892 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:44:08 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
Gk-RB 1..1731 162..1892 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:33 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
CG7995-RA 1..2301 1..2301 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:22 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
CG7995-RA 16..2316 1..2301 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:38:28 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
Gk-RA 18..2318 1..2301 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-15 15:25:24 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
CG7995-RA 1..2301 1..2301 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:44:08 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
Gk-RA 18..2318 1..2301 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:44:08 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1743904..1745421 784..2301 100   Plus
3L 1743208..1743834 157..783 100 -> Plus
3L 1741855..1742010 1..156 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:38:28 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1743904..1745421 784..2301 100   Plus
arm_3L 1743208..1743834 157..783 100 -> Plus
arm_3L 1741855..1742010 1..156 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:39 Download gff for FI03690.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1743904..1745421 784..2301 100   Plus
3L 1743208..1743834 157..783 100 -> Plus
3L 1741855..1742010 1..156 100 -> Plus

FI03690.pep Sequence

Translation from 161 to 1891

> FI03690.pep
MTEGKNLPHSSADVPFRSKELRKQSLIQHTGLVGVIDEGTKTIGFSIYTT
PDFKEIAAHRVELSVITPQDGWYEQDPLEMMASINKCAEEAIKQLPEQGF
SASDIVTVGITNQRETTIVWDAVTGKPLYNALLWKDIRTSTTVEQIVAKV
QDPNHFRSSTGLPISTYFSALKIRWLRDNVPEVRQAIRERRCKAGTVDSW
IVWNLTNGALHITDVTNASRTLLMNLETQAWDPVLLKTFGIREEMLPTIH
SCSEIFGKITSERSPLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSG
CFLLCNTGDKPVFSRHGLLTTVAYKLGPQAPTIYAIEGAVSVAGHALSWL
QNKVRILPDSRDAEKYAEMVPTSGDVYFVPAFTGLYAPYWRQNARGIIIG
LTQFTRKNHIVRAALESICFQTRDILECMHQECGYEINKLHADGKLTTNN
LLMQLQADTIGMPVFRSQLMDSTAFGAAMCAAQADGVNLCQFEPEKRYYE
NVHYDTFLATTTDVERKERYGKWKRAVERSLGWVIKQKKTREYTEENYRM
LSSLPASIFLISSFAMLVHSLAASGQ*

FI03690.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24829-PA 576 GF24829-PA 1..576 1..576 3072 97.4 Plus
Dana\GF24830-PA 552 GF24830-PA 2..547 30..574 2421 81.5 Plus
Dana\GF10570-PA 540 GF10570-PA 22..524 33..533 1229 46.5 Plus
Dana\GF12283-PA 596 GF12283-PA 11..585 31..568 942 37.5 Plus
Dana\GF24265-PA 558 GF24265-PA 69..557 63..533 464 27.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14819-PA 576 GG14819-PA 1..576 1..576 3115 99.1 Plus
Dere\GG14680-PA 538 GG14680-PA 19..522 32..533 1246 46 Plus
Dere\GG20235-PA 596 GG20235-PA 11..585 31..568 928 36.8 Plus
Dere\GG14901-PA 534 GG14901-PA 53..533 57..533 457 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15761-PA 573 GH15761-PA 1..573 1..573 2874 91.1 Plus
Dgri\GH15662-PA 536 GH15662-PA 17..520 32..533 1225 46.4 Plus
Dgri\GH20851-PA 596 GH20851-PA 11..585 31..568 894 36.2 Plus
Dgri\GH14570-PA 513 GH14570-PA 7..512 33..533 537 30.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Gk-PF 576 CG7995-PF 1..576 1..576 3010 100 Plus
Gk-PA 576 CG7995-PA 1..576 1..576 3010 100 Plus
Gk-PB 576 CG7995-PB 1..576 1..576 3010 100 Plus
Gk-PD 576 CG7995-PD 1..576 1..576 3010 100 Plus
Gk-PE 576 CG7995-PE 1..576 1..576 3010 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12540-PA 577 GI12540-PA 1..574 1..574 2900 91.3 Plus
Dmoj\GI12707-PA 535 GI12707-PA 16..519 32..533 1225 46.2 Plus
Dmoj\GI20956-PA 596 GI20956-PA 11..579 31..562 902 37.4 Plus
Dmoj\GI14566-PA 149 GI14566-PA 1..146 429..574 722 88.4 Plus
Dmoj\GI13897-PA 515 GI13897-PA 33..514 57..533 508 29.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20743-PA 576 GL20743-PA 1..576 1..576 3002 94.8 Plus
Dper\GL16108-PA 474 GL16108-PA 3..458 80..533 1158 47.5 Plus
Dper\GL10517-PA 596 GL10517-PA 12..585 32..568 937 37 Plus
Dper\GL20781-PA 531 GL20781-PA 51..530 62..533 435 27.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20751-PA 576 GA20751-PA 1..576 1..576 3004 95 Plus
Dpse\GA14911-PA 532 GA14911-PA 13..516 32..533 1247 46.6 Plus
Dpse\GA20966-PA 596 GA20966-PA 11..585 31..568 938 36.9 Plus
Dpse\GA11767-PA 531 GA11767-PA 51..530 62..533 434 27.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14440-PA 576 GM14440-PA 1..576 1..576 3105 99.3 Plus
Dsec\GM14296-PA 538 GM14296-PA 19..522 32..533 1243 46.4 Plus
Dsec\GM21324-PA 596 GM21324-PA 11..585 31..568 924 36.9 Plus
Dsec\GM14527-PA 537 GM14527-PA 29..536 31..533 445 27.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13642-PA 553 GD13642-PA 1..553 1..576 2972 95.8 Plus
Dsim\GD13534-PA 538 GD13534-PA 19..522 32..533 1243 46.4 Plus
Dsim\GD10831-PA 596 GD10831-PA 11..585 31..568 925 37 Plus
Dsim\GD13724-PA 538 GD13724-PA 30..537 31..533 447 26.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16056-PA 577 GJ16056-PA 1..574 1..574 2902 92 Plus
Dvir\GJ12691-PA 524 GJ12691-PA 5..508 32..533 1220 46.2 Plus
Dvir\GJ20677-PA 596 GJ20677-PA 11..579 31..562 901 37 Plus
Dvir\GJ11752-PA 515 GJ11752-PA 9..514 33..533 523 30 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16636-PA 576 GK16636-PA 1..576 1..576 2972 94.3 Plus
Dwil\GK16855-PA 536 GK16855-PA 17..520 32..533 1221 46.8 Plus
Dwil\GK19496-PA 596 GK19496-PA 11..585 31..568 905 36 Plus
Dwil\GK12322-PA 533 GK12322-PA 18..532 30..533 471 27.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21182-PA 576 GE21182-PA 1..576 1..576 3115 99.3 Plus
Dyak\GE21041-PA 538 GE21041-PA 19..522 32..533 1252 46.6 Plus
Dyak\GE12395-PA 596 GE12395-PA 11..585 31..568 926 37.2 Plus
Dyak\GE20355-PA 538 GE20355-PA 57..537 57..533 454 27.9 Plus

FI03690.hyp Sequence

Translation from 161 to 1891

> FI03690.hyp
MTEGKNLPHSSADVPFRSKELRKQSLIQHTGLVGVIDEGTKTIGFSIYTT
PDFKEIAAHRVELSVITPQDGWYEQDPLEMMASINKCAEEAIKQLPEQGF
SASDIVTVGITNQRETTIVWDAVTGKPLYNALLWKDIRTSTTVEQIVAKV
QDPNHFRSSTGLPISTYFSALKIRWLRDNVPEVRQAIRERRCKAGTVDSW
IVWNLTNGALHITDVTNASRTLLMNLETQAWDPVLLKTFGIREEMLPTIH
SCSEIFGKITSERSPLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSG
CFLLCNTGDKPVFSRHGLLTTVAYKLGPQAPTIYAIEGAVSVAGHALSWL
QNKVRILPDSRDAEKYAEMVPTSGDVYFVPAFTGLYAPYWRQNARGIIIG
LTQFTRKNHIVRAALESICFQTRDILECMHQECGYEINKLHADGKLTTNN
LLMQLQADTIGMPVFRSQLMDSTAFGAAMCAAQADGVNLCQFEPEKRYYE
NVHYDTFLATTTDVERKERYGKWKRAVERSLGWVIKQKKTREYTEENYRM
LSSLPASIFLISSFAMLVHSLAASGQ*

FI03690.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
Gk-PF 576 CG7995-PF 1..576 1..576 3010 100 Plus
Gk-PA 576 CG7995-PA 1..576 1..576 3010 100 Plus
Gk-PB 576 CG7995-PB 1..576 1..576 3010 100 Plus
Gk-PD 576 CG7995-PD 1..576 1..576 3010 100 Plus
Gk-PE 576 CG7995-PE 1..576 1..576 3010 100 Plus