Clone FI03732 Report

Search the DGRC for FI03732

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:37
Well:32
Vector:pOT2
Associated Gene/Transcriptmus308-RA
Protein status:FI03732.pep: gold
Sequenced Size:6437

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mus308 2008-08-15 Release 5.9 accounting
mus308 2008-12-18 5.12 accounting

Clone Sequence Records

FI03732.complete Sequence

6437 bp assembled on 2008-07-17

GenBank Submission: BT044169.1

> FI03732.complete
ACCGCGCGACGTTTCGTTTTCATTTTATTCATTTCACTTGTAACAAGCAG
TTTGCAACAATTCTTAGTTCAGTATAAAAACGCACCGGCGCAATGGCATT
CTCGCAGTCGTTCAACTTCGGAAACAGCACCTTAATGGCGCTGGAGAAAG
GAATGCAAGCGGACGACAAGGAGAATGCACAGCCAGGAAACGGAAATATC
CAAGTCCAAAGTGCCGGCAATGAGGTAAATAGCGAGATCCAGGAAATTAA
CTCGGAGTTTTTCCGGGACGAGTTCTCCTACGAAGTGAATCAGGCCCATA
AGCCAGCTGAACAATCAGTGGTCAATGTGTCTCAGGTTCAGCAGCATATG
GCAGTTGTTTCCAATCAGGACTCTGAGGATCAGAGCCGCTCATCCGCTTT
GAATGACCAAATCTGCACACAGTCTTCGTTCGAGGGCGAGGACGCAGGCG
CGGATGCAGTGCTGGATCAGCCCAATCTGGATGAGAACAGCTTTTTGTGT
CCTGCGCAGGATGAAGAGGCTTCCGAGCAGCTGAAGGAAGACATCTTGCA
CAGTCATTCCGTATTGGCCAAGCAGGAATTCTATCAAGAGATTTCGCAAG
TCACGCAGAACCTGAGCAGCATGTCGCCCAACCAACTGCGAGTGTCGCCC
AACTCCTCGAGGATCCGCGAAGCGATGCCCGAAAGACCAGCAATGCCACT
TGATCTCAACACGCTTAGATCAATAAGCGCATGGAACCTGCCCATGAGCA
TTCAAGCGGAGTACAAGAAGAAGGGTGTTGTCGATATGTTCGACTGGCAG
GTGGAGTGTCTCTCCAAGCCTAGATTGCTGTTTGAGCACTGCAACCTGGT
TTATTCAGCACCCACGTCGGCAGGCAAGACGTTGGTTAGTGAGATACTGA
TGCTGAAAACCGTACTGGAGCGAGGTAAAAAGGTGCTGCTCATACTGCCC
TTCATCTCGGTGGTGCGCGAGAAAATGTTCTACATGCAGGATCTGCTCAC
GCCGGCTGGTTACCGCGTGGAGGGATTCTACGGCGGCTATACGCCACCAG
GAGGCTTTGAGAGCCTTCATGTGGCCATTTGCACAATTGAGAAGGCGAAC
TCCATTGTGAACAAGCTGATGGAGCAGGGCAAACTGGAAACCATTGGCAT
GGTGGTGGTAGACGAAGTGCATCTCATTTCGGACAAGGGACGCGGCTATA
TCCTGGAACTTCTGCTAGCCAAGATCCTCTACATGTCCCGTCGCAATGGA
CTGCAGATCCAGGTGATCACCATGTCGGCCACACTCGAGAATGTGCAGCT
GCTGCAGAGCTGGCTTGACGCCGAGTTGTACATCACAAACTACCGACCCG
TTGCTCTAAAGGAAATGATTAAGGTGGGCACAGTAATTTATGACCACCGT
TTGAAATTAGTTCGAGATGTGGCCAAGCAAAAGGTACTTTTGAAAGGCCT
GGAAAACGATTCCGATGATGTGGCCCTTCTCTGCATAGAGACGTTGCTGG
AGGGATGCTCGGTAATCGTGTTCTGCCCCTCGAAAGATTGGTGCGAGAAC
CTGGCCGTTCAATTGGCCACCGCAATCCATGTCCAAATCAAATCTGAAAC
AGTGCTGGGCCAGCGATTGAGAACAAATCTAAATCCGAGGGCCATTGCAG
AAGTGAAGCAACAACTCAGGGACATTCCCACAGGTCTCGATGGGGTCATG
TCGAAGGCGATCACCTACGCCTGCGCGTTTCACCACGCCGGCCTAACTAC
GGAGGAGCGGGACATTATTGAAGCCTCGTTTAAGGCAGGAGCACTGAAGG
TTCTAGTCGCCACCAGCACACTGAGTTCGGGAGTGAATCTGCCCGCTCGG
CGCGTCCTGATACGCTCGCCATTATTTGGGGGCAAGCAAATGAGTTCCCT
AACGTACCGCCAGATGATCGGACGAGCTGGACGCATGGGAAAGGATACGC
TGGGTGAGTCTATTCTCATCTGCAACGAGATCAATGCCCGAATGGGAAGA
GACCTGGTCGTATCGGAGCTGCAGCCCATTACTTCCTGCCTCGATATGGA
CGGAAGCACCCACTTGAAGCGCGCTCTACTCGAGGTAATTTCTTCTGGTG
TAGCGAACACCAAAGAAGACATCGACTTCTTCGTGAATTGTACTCTGCTG
AGTGCCCAAAAGGCCTTCCACGCAAAGGAGAAACCACCCGATGAGGAATC
GGACGCCAACTACATTAACGATGCCCTCGACTTTCTTGTGGAGTACGAGT
TCGTTCGCCTGCAAAGGAACGAGGAAAGGGAGACAGCGGTCTATGTGGCC
ACTCGTCTCGGTGCCGCCTGTCTGGCTTCCTCTATGCCGCCCACCGACGG
CCTCATTCTTTTTGCGGAACTCCAGAAATCTCGTCGCTCCTTCGTCCTAG
AGTCAGAACTGCATGCTGTTTACCTAGTAACGCCCTATTCTGTCTGCTAC
CAACTTCAAGATATCGACTGGCTGCTGTATGTGCATATGTGGGAAAAGTT
AAGTTCGCCCATGAAAAAAGTGGGCGAGCTTGTTGGAGTCAGGGACGCCT
TTCTCTACAAAGCGCTGCGTGGTCAAACAAAACTAGACTACAAGCAAATG
CAAATACATAAGCGTTTCTACATAGCTCTGGCTCTGGAGGAACTGGTAAA
CGAAACACCCATAAACGTCGTGGTCCACAAGTATAAGTGCCACCGAGGAA
TGCTACAGAGTCTGCAGCAAATGGCCTCGACCTTTGCAGGCATTGTTACT
GCTTTCTGCAATTCTCTGCAGTGGTCCACACTCGCCCTGATCGTGTCCCA
ATTTAAGGATCGTCTCTTCTTTGGCATTCACAGGGATCTTATCGATCTGA
TGCGAATACCCGATCTGTCGCAGAAACGAGCTCGTGCTCTCTTTGATGCT
GGCATCACCAGTTTGGTAGAGCTAGCGGGCGCTGATCCCGTAGAATTGGA
AAAGGTGCTCTATAACTCAATCAGCTTCGACTCTGCAAAGCAACACGACC
ACGAGAACGCGGATGAAGCGGCCAAGCGAAATGTAGTTAGAAATTTCTAT
ATCACAGGCAAGGCGGGGATGACAGTGAGCGAGGCTGCCAAACTACTGAT
TGGTGAAGCTCGACAATTTGTTCAGCACGAGATCGGACTGGGCACAATTA
AATGGACCCAAACTCAGGCGGGAGTGGAAATAGCTTCGAGGGCAATACAC
GATGGCGGGGAGGTAGACCTCCACATGTCCCTGGAGGAGGAGCAGCCGCC
AGTAAAGAGGAAATTGTCCATCGAAGAAAATGGCACAGCCAATTCACAAA
AAAATCCCAGACTCGAAACAGTAGTGGACACACAGCGAGGCTATAAAGTT
GATAAGAATATTGCTAATCAAAGCAAGATGAACCCGAATCTTAAAGAAAT
CGATGCCCAAAATAAGGCGCGAAGGAATTCAACTGCACACATGGATAACC
TAAACCCGATTAGCAATGACCCTTGTCAGAACAACGTAAACGTAAAAACG
GCACAACCCATAATATCCAATTTGAATGACATCCAGAAACAAGGTTCTCA
GATTGAAAAGATGAAAATCAATCCAGCAACTGTGGTGTGTAGTCCACAAT
TAGCAAATGAAGAAAAACCGAGTACCAGTCAAAGTGCTAGAAGGAAGCTC
GTTAATGAGGGAATGGCCGAACGCCGCAGGGTCGCTTTAATGAAGATTCA
GCAACGCACCCAAAAAGAGAACCAGTCTAAGGATCAGCCAATACAGGCGT
CGAGGTCTAACCAACTTTCAAGTCCGGTTAATAGAACACCCGCAAATCGA
TGGACACAATCGGAAAACCCAAACAATGAGATGAACAATAGTCAACTGCC
CCGCAGAAATCCACGAAATCAATCACCAGTACCCAATGCAAACCGCACTG
CGTCAAGGAAGGTTTCCAACGCAGAGGAGGATTTGTTTATGGCAGACGAT
TCCTTTATGCTGAATACCGGTCTAGCCGCTGCTCTCACGGCCGCTGAGAG
CAAAATTGCCTCTTGCACGGAGGCGGACGTGATACCTAGCTCGCAACCTA
AGGAGCCGGAAGTGATCGGTGCACTGACTCCACATGCATCCAGACTGAAG
CGTTCCGACCAGTTGCGTTCACAGCGCATACAAAGTCCCAGCCCCACCCC
GCAACGTGAAATCGAAATTGATTTGGAATCGAAAAACGAATCCAATGGGG
TCTCCTCTATGGAAATCTCGGACATGTCTATGGAGAACCCACTCATGAAA
AATCCTTTACATCTAAATGCCTCGCACATTATGAGCTGTTCGAAAGTCGA
TGAAACTGCGTCGAGTTTCTCTTCTATAGATATAATCGATGTGTGTGGCC
ACCGGAATGCGTTTCAAGCTGCTATCATCGAGATCAATAACGCCACGCGT
TTGGGATTTAGCGTTGGCCTGCAGGCTCAAGCGGGCAAACAGAAGCCGCT
AATTGGATCCAACCTCTTGATCAATCAAGTTGCGGCGGCCGAGAACCGGG
AGGCGGCTGCCAGGGAACGTGTGCTATTCCAAGTGGACGACACCAACTTC
ATCTCTGGTGTGTCTTTCTGTCTTGCGGACAATGTTGCCTACTATTGGAA
TATGCAAATTGACGAACGTGCAGCATATCAGGGAGTGCCCACCCCTCTCA
AGGTGCAGGAATTGTGCAACCTGATGGCTCGAAAGGATCTCACGCTGGTC
ATGCACGACGGAAAGGAGCAGCTTAAGATGCTGCGCAAAGCGATTCCGCA
GCTAAAAAGGATTAGCGCCAAGCTGGAGGATGCCAAGGTCGCAAACTGGC
TGCTGCAGCCGGACAAAACTGTGAATTTTCTCAATATGTGCCAGACATTC
GCCCCGGAATGCACTGGCCTTGCGAATCTCTGTGGCAGTGGTCGTGGTTA
TAGCAGCTACGGGCTTGATACCTCCAGTGCCATTTTGCCGAGGATTAGGA
CGGCCATCGAATCCTGCGTAACGCTGCACATACTCCAGGGACAGACTGAG
AACCTAAGCAGGATTGGCAATGGTGACTTACTTAAGTTTTTCCACGATAT
CGAAATGCCCATTCAATTGACTCTTTGTCAAATGGAGCTTGTGGGCTTTC
CCGCCCAGAAGCAGCGACTCCAACAGCTTTATCAGCGCATGGTGGCCGTT
ATGAAGAAAGTGGAAACAAAGATTTATGAGCAGCATGGTTCCCGTTTCAA
TCTGGGCTCGTCACAAGCTGTTGCCAAGGTGCTGGGACTCCACCGGAAAG
CAAAAGGACGAGTTACCACCTCACGCCAGGTGCTGGAGAAGTTGAACTCG
CCCATTTCGCATTTGATACTAGGCTATCGAAAGCTGTCTGGGCTCTTGGC
CAAAAGCATTCAGCCGCTAATGGAGTGCTGCCAGGCAGACAGAATTCATG
GCCAGAGCATTACATATACGGCAACGGGTCGTATTTCCATGACGGAGCCG
AACCTGCAAAATGTCGCCAAAGAATTCAGCATACAAGTGGGCTCTGATGT
GGTCCACATATCCTGTAGGTCACCATTCATGCCCACGGATGAGAGCCGAT
GTCTTTTGTCGGCTGACTTCTGTCAGCTGGAGATGCGGATCCTTGCCCAC
ATGTCTCAGGATAAGGCTCTGTTGGAGGTGATGAAATCGTCACAGGACCT
GTTCATCGCAATTGCAGCGCATTGGAACAAAATCGAAGAGTCCGAAGTGA
CGCAGGACCTCCGCAACAGCACCAAGCAGGTGTGCTACGGAATCGTCTAC
GGCATGGGCATGCGGTCCCTGGCCGAGTCGTTAAACTGCAGTGAGCAGGA
GGCGCGGATGATATCCGATCAGTTTCACCAGGCGTACAAGGGTATTCGCG
ATTACACCACGAGGGTGGTCAATTTCGCACGCAGCAAGGGATTTGTTGAG
ACCATTACTGGACGGCGACGGTATTTGGAAAATATCAACAGTGATGTGGA
GCATCTAAAAAATCAGGCCGAGCGCCAGGCCGTTAACTCCACCATCCAAG
GATCGGCTGCGGATATTGCGAAGAACGCTATTCTGAAGATGGAAAAGAAC
ATTGAACGTTATCGCGAAAAGCTGGCATTGGGTGACAATTCAGTTGACCT
GGTAATGCACCTACATGACGAACTCATTTTCGAGGTGCCAACGGGAAAGG
CCAAAAAAATAGCCAAAGTCCTTAGCCTCACCATGGAGAACTGCGTGAAA
CTCAGCGTGCCACTCAAGGTGAAGCTGAGGATCGGACGCAGTTGGGGTGA
ATTTAAGGAAGTTAGCGTGTAGTTTATTATATCATTTTATAGATTTGTAA
TCAATTTGTTTAAAGACTGAATGTTTTAGGACTGCTTGGCCTGCCACTCC
GTCCATGATCCGGCATAAGCCTTGGCGCTGCAATTGATTAATAAATAATT
GTACATATCTTTTAAAACGTAAAAAAAAAAAAAAAAA

FI03732.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
mus308-RA 6435 mus308-RA 16..6435 1..6420 32100 100 Plus
CG12279-RA 779 CG12279-RA 501..779 6377..6099 1395 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8532529..8534756 4838..2614 11015 99.7 Minus
chr3R 27901430 chr3R 8535865..8537549 1685..1 8395 99.9 Minus
chr3R 27901430 chr3R 8531295..8532210 5961..5046 4565 99.9 Minus
chr3R 27901430 chr3R 8534815..8535371 2614..2058 2770 99.8 Minus
chr3R 27901430 chr3R 8530770..8531228 6420..5962 2295 100 Minus
chr3R 27901430 chr3R 8535426..8535801 2057..1682 1865 99.7 Minus
chr3R 27901430 chr3R 8532268..8532476 5046..4838 1045 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
mus308-RA 6180 CG6019-PA 1..6180 93..6272 30900 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
mus308-RA 6420 CG6019-RA 1..6420 1..6420 32100 100 Plus
CG12279-RA 601 CG12279-RA 349..601 6377..6125 1265 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
mus308-PA 2059 CG6019-PA 1..2059 93..6269 10165 100 Plus
mus301-PA 1051 CG7972-PA 99..1008 288..2960 790 28.5 Plus
l(3)72Ab-PA 2142 CG5931-PA 498..891 843..2036 299 27.4 Plus
CG5205-PA 2183 CG5205-PA 1354..1718 843..1979 268 24.4 Plus
l(2)35Df-PA 1055 CG4152-PA 168..596 843..2093 267 25.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12707282..12709506 4838..2614 11125 100 Minus
3R 32079331 3R 12710615..12712299 1685..1 8425 100 Minus
3R 32079331 3R 12706048..12706963 5961..5046 4580 100 Minus
3R 32079331 3R 12709565..12710121 2614..2058 2785 100 Minus
3R 32079331 3R 12705522..12705981 6421..5962 2300 100 Minus
3R 32079331 3R 12710176..12710551 2057..1682 1880 100 Minus
3R 32079331 3R 12707021..12707229 5046..4838 1045 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12448113..12450337 4838..2614 11125 100 Minus
3R 31820162 3R 12451446..12453130 1685..1 8425 100 Minus
3R 31820162 3R 12446879..12447794 5961..5046 4580 100 Minus
3R 31820162 3R 12450396..12450952 2614..2058 2785 100 Minus
3R 31820162 3R 12446353..12446812 6421..5962 2300 100 Minus
3R 31820162 3R 12451007..12451382 2057..1682 1880 100 Minus
3R 31820162 3R 12447852..12448060 5046..4838 1045 100 Minus
Blast to na_te.dros performed on 2014-11-27 03:46:16 has no hits.

FI03732.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:40:57 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8535867..8537549 1..1683 99   Minus
chr3R 8535426..8535799 1684..2057 99 <- Minus
chr3R 8534815..8535371 2058..2614 99 <- Minus
chr3R 8532529..8534755 2615..4838 99 <- Minus
chr3R 8532268..8532475 4839..5046 100 <- Minus
chr3R 8531295..8532209 5047..5961 99 <- Minus
chr3R 8530770..8531228 5962..6420 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:46:13 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 1..6180 93..6272 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:40 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 1..6180 93..6272 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:06 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 1..6180 93..6272 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:04 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 1..6180 93..6272 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:40:57 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 1..6180 93..6272 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:28:50 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 1..6180 93..6272 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:40 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 1..6420 1..6420 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:06 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 1..6420 1..6420 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:04 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 1..6180 93..6272 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:40:57 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
mus308-RA 1..6420 1..6420 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:40:57 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12710617..12712299 1..1683 100   Minus
3R 12710176..12710549 1684..2057 100 <- Minus
3R 12709565..12710121 2058..2614 100 <- Minus
3R 12707282..12709505 2615..4838 100 <- Minus
3R 12707021..12707228 4839..5046 100 <- Minus
3R 12706048..12706962 5047..5961 100 <- Minus
3R 12705523..12705981 5962..6420 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:06 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8536339..8538021 1..1683 100   Minus
arm_3R 8535898..8536271 1684..2057 100 <- Minus
arm_3R 8535287..8535843 2058..2614 100 <- Minus
arm_3R 8533004..8535227 2615..4838 100 <- Minus
arm_3R 8532743..8532950 4839..5046 100 <- Minus
arm_3R 8531770..8532684 5047..5961 100 <- Minus
arm_3R 8531245..8531703 5962..6420 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:26 Download gff for FI03732.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12451448..12453130 1..1683 100   Minus
3R 12451007..12451380 1684..2057 100 <- Minus
3R 12450396..12450952 2058..2614 100 <- Minus
3R 12448113..12450336 2615..4838 100 <- Minus
3R 12447852..12448059 4839..5046 100 <- Minus
3R 12446879..12447793 5047..5961 100 <- Minus
3R 12446354..12446812 5962..6420 100 <- Minus

FI03732.pep Sequence

Translation from 92 to 6271

> FI03732.pep
MAFSQSFNFGNSTLMALEKGMQADDKENAQPGNGNIQVQSAGNEVNSEIQ
EINSEFFRDEFSYEVNQAHKPAEQSVVNVSQVQQHMAVVSNQDSEDQSRS
SALNDQICTQSSFEGEDAGADAVLDQPNLDENSFLCPAQDEEASEQLKED
ILHSHSVLAKQEFYQEISQVTQNLSSMSPNQLRVSPNSSRIREAMPERPA
MPLDLNTLRSISAWNLPMSIQAEYKKKGVVDMFDWQVECLSKPRLLFEHC
NLVYSAPTSAGKTLVSEILMLKTVLERGKKVLLILPFISVVREKMFYMQD
LLTPAGYRVEGFYGGYTPPGGFESLHVAICTIEKANSIVNKLMEQGKLET
IGMVVVDEVHLISDKGRGYILELLLAKILYMSRRNGLQIQVITMSATLEN
VQLLQSWLDAELYITNYRPVALKEMIKVGTVIYDHRLKLVRDVAKQKVLL
KGLENDSDDVALLCIETLLEGCSVIVFCPSKDWCENLAVQLATAIHVQIK
SETVLGQRLRTNLNPRAIAEVKQQLRDIPTGLDGVMSKAITYACAFHHAG
LTTEERDIIEASFKAGALKVLVATSTLSSGVNLPARRVLIRSPLFGGKQM
SSLTYRQMIGRAGRMGKDTLGESILICNEINARMGRDLVVSELQPITSCL
DMDGSTHLKRALLEVISSGVANTKEDIDFFVNCTLLSAQKAFHAKEKPPD
EESDANYINDALDFLVEYEFVRLQRNEERETAVYVATRLGAACLASSMPP
TDGLILFAELQKSRRSFVLESELHAVYLVTPYSVCYQLQDIDWLLYVHMW
EKLSSPMKKVGELVGVRDAFLYKALRGQTKLDYKQMQIHKRFYIALALEE
LVNETPINVVVHKYKCHRGMLQSLQQMASTFAGIVTAFCNSLQWSTLALI
VSQFKDRLFFGIHRDLIDLMRIPDLSQKRARALFDAGITSLVELAGADPV
ELEKVLYNSISFDSAKQHDHENADEAAKRNVVRNFYITGKAGMTVSEAAK
LLIGEARQFVQHEIGLGTIKWTQTQAGVEIASRAIHDGGEVDLHMSLEEE
QPPVKRKLSIEENGTANSQKNPRLETVVDTQRGYKVDKNIANQSKMNPNL
KEIDAQNKARRNSTAHMDNLNPISNDPCQNNVNVKTAQPIISNLNDIQKQ
GSQIEKMKINPATVVCSPQLANEEKPSTSQSARRKLVNEGMAERRRVALM
KIQQRTQKENQSKDQPIQASRSNQLSSPVNRTPANRWTQSENPNNEMNNS
QLPRRNPRNQSPVPNANRTASRKVSNAEEDLFMADDSFMLNTGLAAALTA
AESKIASCTEADVIPSSQPKEPEVIGALTPHASRLKRSDQLRSQRIQSPS
PTPQREIEIDLESKNESNGVSSMEISDMSMENPLMKNPLHLNASHIMSCS
KVDETASSFSSIDIIDVCGHRNAFQAAIIEINNATRLGFSVGLQAQAGKQ
KPLIGSNLLINQVAAAENREAAARERVLFQVDDTNFISGVSFCLADNVAY
YWNMQIDERAAYQGVPTPLKVQELCNLMARKDLTLVMHDGKEQLKMLRKA
IPQLKRISAKLEDAKVANWLLQPDKTVNFLNMCQTFAPECTGLANLCGSG
RGYSSYGLDTSSAILPRIRTAIESCVTLHILQGQTENLSRIGNGDLLKFF
HDIEMPIQLTLCQMELVGFPAQKQRLQQLYQRMVAVMKKVETKIYEQHGS
RFNLGSSQAVAKVLGLHRKAKGRVTTSRQVLEKLNSPISHLILGYRKLSG
LLAKSIQPLMECCQADRIHGQSITYTATGRISMTEPNLQNVAKEFSIQVG
SDVVHISCRSPFMPTDESRCLLSADFCQLEMRILAHMSQDKALLEVMKSS
QDLFIAIAAHWNKIEESEVTQDLRNSTKQVCYGIVYGMGMRSLAESLNCS
EQEARMISDQFHQAYKGIRDYTTRVVNFARSKGFVETITGRRRYLENINS
DVEHLKNQAERQAVNSTIQGSAADIAKNAILKMEKNIERYREKLALGDNS
VDLVMHLHDELIFEVPTGKAKKIAKVLSLTMENCVKLSVPLKVKLRIGRS
WGEFKEVSV*

FI03732.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17871-PA 2135 GF17871-PA 1..2135 1..2059 6268 58 Plus
Dana\GF23962-PA 1049 GF23962-PA 246..998 214..945 787 29.8 Plus
Dana\GF10367-PA 2142 GF10367-PA 498..891 251..648 310 27.7 Plus
Dana\GF18303-PA 2184 GF18303-PA 1347..1766 249..680 307 24.5 Plus
Dana\GF14920-PA 1047 GF14920-PA 160..573 251..652 270 26.1 Plus
Dana\GF18303-PA 2184 GF18303-PA 505..880 251..628 247 26 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17101-PA 2037 GG17101-PA 1..1403 1..1354 5657 78.2 Plus
Dere\GG17101-PA 2037 GG17101-PA 1403..2034 1425..2056 2819 83.7 Plus
Dere\GG14474-PA 1052 GG14474-PA 260..1009 227..956 792 30.5 Plus
Dere\GG13510-PA 2142 GG13510-PA 498..891 251..648 305 27.4 Plus
Dere\GG16932-PA 2183 GG16932-PA 1346..1765 249..680 288 23.8 Plus
Dere\GG25171-PA 1051 GG25171-PA 164..577 251..652 275 25.9 Plus
Dere\GG16932-PA 2183 GG16932-PA 504..879 251..628 226 25.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22128-PA 2218 GH22128-PA 1..2218 1..2059 6798 61.1 Plus
Dgri\GH25245-PA 2235 GH25245-PA 1..2235 1..2059 6773 60.4 Plus
Dgri\GH16173-PA 1063 GH16173-PA 255..1018 214..956 748 28.9 Plus
Dgri\GH16760-PA 2142 GH16760-PA 498..891 251..648 312 27.9 Plus
Dgri\GH19081-PA 2181 GH19081-PA 1346..1765 249..680 292 24.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
mus308-PA 2059 CG6019-PA 1..2059 1..2059 10452 100 Plus
mus301-PA 1051 CG7972-PA 99..1008 66..956 820 28.5 Plus
l(3)72Ab-PA 2142 CG5931-PA 498..891 251..648 307 27.4 Plus
CG5205-PA 2183 CG5205-PA 1354..1718 251..629 287 25.6 Plus
l(2)35Df-PA 1055 CG4152-PA 168..596 251..667 270 25.9 Plus
CG5205-PA 2183 CG5205-PA 504..877 251..626 232 24.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21961-PA 2181 GI21961-PA 1..2181 1..2059 6772 61.3 Plus
Dmoj\GI13326-PA 1022 GI13326-PA 227..979 224..956 799 29.7 Plus
Dmoj\GI13421-PA 2142 GI13421-PA 498..891 251..648 310 27.9 Plus
Dmoj\GI23225-PA 2178 GI23225-PA 1342..1761 249..680 302 24.3 Plus
Dmoj\GI13953-PA 1063 GI13953-PA 175..588 251..652 266 25.4 Plus
Dmoj\GI23225-PA 2178 GI23225-PA 500..875 251..628 225 24.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23113-PA 2193 GL23113-PA 1..1074 1..1097 3831 66.2 Plus
Dper\GL23113-PA 2193 GL23113-PA 1208..2193 1101..2059 2652 54.1 Plus
Dper\GL22611-PA 1029 GL22611-PA 261..984 227..952 784 29.7 Plus
Dper\GL23759-PA 2182 GL23759-PA 1344..1716 249..629 298 25.4 Plus
Dper\GL23759-PA 2182 GL23759-PA 502..875 251..626 227 25.4 Plus
Dper\GL15456-PA 760 GL15456-PA 368..546 472..652 212 33.9 Plus
Dper\GL24270-PA 1197 GL24270-PA 370..669 354..627 210 27.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19301-PB 1998 GA19301-PB 1..1998 1..2059 6446 60.9 Plus
Dpse\GA20732-PA 1052 GA20732-PA 261..1007 227..952 780 29.7 Plus
Dpse\GA19239-PA 2142 GA19239-PA 498..891 251..648 305 27.7 Plus
Dpse\GA18736-PA 2182 GA18736-PA 1344..1716 249..629 295 25.4 Plus
Dpse\GA17990-PA 1057 GA17990-PA 170..583 251..652 279 26.1 Plus
Dpse\GA18736-PA 2182 GA18736-PA 502..875 251..626 227 25.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25985-PA 2006 GM25985-PA 1..2006 1..2059 9819 90.1 Plus
Dsec\GM25023-PA 1050 GM25023-PA 258..1007 227..956 816 30.5 Plus
Dsec\GM24241-PA 2181 GM24241-PA 1344..1763 249..680 292 24.5 Plus
Dsec\GM16128-PA 1051 GM16128-PA 164..577 251..652 274 25.9 Plus
Dsec\GM23539-PA 1197 GM23539-PA 259..669 233..627 218 26.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20545-PA 1025 GD20545-PA 1..1025 1..1027 5171 93.6 Plus
Dsim\GD20546-PA 967 GD20546-PA 1..967 1045..2059 4505 86.9 Plus
Dsim\GD14056-PA 1011 GD14056-PA 260..968 227..956 663 28.2 Plus
Dsim\GD12527-PA 1805 GD12527-PA 498..891 251..648 302 27.2 Plus
Dsim\GD19029-PA 2182 GD19029-PA 1345..1764 249..680 291 24.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14321-PA 2086 GJ14321-PA 1..2086 1..2059 6877 63.9 Plus
Dvir\GJ13152-PA 1025 GJ13152-PA 228..980 224..956 772 29.3 Plus
Dvir\GJ11781-PA 2142 GJ11781-PA 498..891 251..648 310 27.9 Plus
Dvir\GJ22884-PA 2179 GJ22884-PA 1344..1763 249..680 285 23.8 Plus
Dvir\GJ18233-PA 1069 GJ18233-PA 182..595 251..652 264 25.6 Plus
Dvir\GJ22884-PA 2179 GJ22884-PA 502..875 251..626 226 25.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13557-PA 2080 GK13557-PA 1..1186 1..1232 3953 64 Plus
Dwil\GK20010-PA 1063 GK20010-PA 262..1019 224..954 795 29.6 Plus
Dwil\GK11465-PA 2181 GK11465-PA 1344..1763 249..680 296 24.1 Plus
Dwil\GK24759-PA 1049 GK24759-PA 162..575 251..652 286 26.3 Plus
Dwil\GK23638-PA 1808 GK23638-PA 506..871 251..619 281 26.6 Plus
Dwil\GK11465-PA 2181 GK11465-PA 502..875 251..626 232 25.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24491-PA 2043 GE24491-PA 1..2040 1..2056 8734 81.1 Plus
Dyak\GE21661-PA 1052 GE21661-PA 260..1009 227..956 821 30.5 Plus
Dyak\GE23129-PA 1733 GE23129-PA 498..891 251..648 306 27.4 Plus
Dyak\GE24317-PA 2183 GE24317-PA 1346..1765 249..680 297 24.1 Plus
Dyak\GE21122-PA 1047 GE21122-PA 160..573 251..652 276 25.9 Plus
Dyak\GE24317-PA 2183 GE24317-PA 504..879 251..628 228 25.6 Plus

FI03732.hyp Sequence

Translation from 92 to 6271

> FI03732.hyp
MAFSQSFNFGNSTLMALEKGMQADDKENAQPGNGNIQVQSAGNEVNSEIQ
EINSEFFRDEFSYEVNQAHKPAEQSVVNVSQVQQHMAVVSNQDSEDQSRS
SALNDQICTQSSFEGEDAGADAVLDQPNLDENSFLCPAQDEEASEQLKED
ILHSHSVLAKQEFYQEISQVTQNLSSMSPNQLRVSPNSSRIREAMPERPA
MPLDLNTLRSISAWNLPMSIQAEYKKKGVVDMFDWQVECLSKPRLLFEHC
NLVYSAPTSAGKTLVSEILMLKTVLERGKKVLLILPFISVVREKMFYMQD
LLTPAGYRVEGFYGGYTPPGGFESLHVAICTIEKANSIVNKLMEQGKLET
IGMVVVDEVHLISDKGRGYILELLLAKILYMSRRNGLQIQVITMSATLEN
VQLLQSWLDAELYITNYRPVALKEMIKVGTVIYDHRLKLVRDVAKQKVLL
KGLENDSDDVALLCIETLLEGCSVIVFCPSKDWCENLAVQLATAIHVQIK
SETVLGQRLRTNLNPRAIAEVKQQLRDIPTGLDGVMSKAITYACAFHHAG
LTTEERDIIEASFKAGALKVLVATSTLSSGVNLPARRVLIRSPLFGGKQM
SSLTYRQMIGRAGRMGKDTLGESILICNEINARMGRDLVVSELQPITSCL
DMDGSTHLKRALLEVISSGVANTKEDIDFFVNCTLLSAQKAFHAKEKPPD
EESDANYINDALDFLVEYEFVRLQRNEERETAVYVATRLGAACLASSMPP
TDGLILFAELQKSRRSFVLESELHAVYLVTPYSVCYQLQDIDWLLYVHMW
EKLSSPMKKVGELVGVRDAFLYKALRGQTKLDYKQMQIHKRFYIALALEE
LVNETPINVVVHKYKCHRGMLQSLQQMASTFAGIVTAFCNSLQWSTLALI
VSQFKDRLFFGIHRDLIDLMRIPDLSQKRARALFDAGITSLVELAGADPV
ELEKVLYNSISFDSAKQHDHENADEAAKRNVVRNFYITGKAGMTVSEAAK
LLIGEARQFVQHEIGLGTIKWTQTQAGVEIASRAIHDGGEVDLHMSLEEE
QPPVKRKLSIEENGTANSQKNPRLETVVDTQRGYKVDKNIANQSKMNPNL
KEIDAQNKARRNSTAHMDNLNPISNDPCQNNVNVKTAQPIISNLNDIQKQ
GSQIEKMKINPATVVCSPQLANEEKPSTSQSARRKLVNEGMAERRRVALM
KIQQRTQKENQSKDQPIQASRSNQLSSPVNRTPANRWTQSENPNNEMNNS
QLPRRNPRNQSPVPNANRTASRKVSNAEEDLFMADDSFMLNTGLAAALTA
AESKIASCTEADVIPSSQPKEPEVIGALTPHASRLKRSDQLRSQRIQSPS
PTPQREIEIDLESKNESNGVSSMEISDMSMENPLMKNPLHLNASHIMSCS
KVDETASSFSSIDIIDVCGHRNAFQAAIIEINNATRLGFSVGLQAQAGKQ
KPLIGSNLLINQVAAAENREAAARERVLFQVDDTNFISGVSFCLADNVAY
YWNMQIDERAAYQGVPTPLKVQELCNLMARKDLTLVMHDGKEQLKMLRKA
IPQLKRISAKLEDAKVANWLLQPDKTVNFLNMCQTFAPECTGLANLCGSG
RGYSSYGLDTSSAILPRIRTAIESCVTLHILQGQTENLSRIGNGDLLKFF
HDIEMPIQLTLCQMELVGFPAQKQRLQQLYQRMVAVMKKVETKIYEQHGS
RFNLGSSQAVAKVLGLHRKAKGRVTTSRQVLEKLNSPISHLILGYRKLSG
LLAKSIQPLMECCQADRIHGQSITYTATGRISMTEPNLQNVAKEFSIQVG
SDVVHISCRSPFMPTDESRCLLSADFCQLEMRILAHMSQDKALLEVMKSS
QDLFIAIAAHWNKIEESEVTQDLRNSTKQVCYGIVYGMGMRSLAESLNCS
EQEARMISDQFHQAYKGIRDYTTRVVNFARSKGFVETITGRRRYLENINS
DVEHLKNQAERQAVNSTIQGSAADIAKNAILKMEKNIERYREKLALGDNS
VDLVMHLHDELIFEVPTGKAKKIAKVLSLTMENCVKLSVPLKVKLRIGRS
WGEFKEVSV*

FI03732.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
mus308-PA 2059 CG6019-PA 1..2059 1..2059 10452 100 Plus
mus301-PA 1051 CG7972-PA 99..1008 66..956 820 28.5 Plus
l(3)72Ab-PA 2142 CG5931-PA 498..891 251..648 307 27.4 Plus
CG5205-PA 2183 CG5205-PA 1354..1718 251..629 287 25.6 Plus
l(2)35Df-PA 1055 CG4152-PA 168..596 251..667 270 25.9 Plus
CG5205-PA 2183 CG5205-PA 504..877 251..626 232 24.8 Plus