Clone FI03750 Report

Search the DGRC for FI03750

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:37
Well:50
Vector:pOT2
Associated Gene/Transcriptdrpr-RA
Protein status:FI03750.pep: gold
Sequenced Size:3210

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
drpr 2008-08-15 Release 5.9 accounting
drpr 2008-12-18 5.12 accounting

Clone Sequence Records

FI03750.complete Sequence

3210 bp assembled on 2008-07-17

GenBank Submission: BT044170.1

> FI03750.complete
CTGGCGAGTGCAGCTAAGTAAGTCGGTTGTCCGTTTCTTGCTGAATTTTA
AATAAGTTAAATAAATTTCTGCTTCGTGCGGTGGTGTGCGTACGCAAATA
TAAAATAAAGTAAATAGTAATTGCGGTGCTTGCGAAAACCAAACGAGCTC
CAATTGACCGACGAAAATACTTAAGTGCATTAAAGAATTGCGTTGTTGTG
CGTCGCGCCCGTTTGTCCTTATTGTTGTCGTTAGTGGAGTGCACGAAAAG
TAATTGTTTTTATTTAAAGAGGTTGCATTTTAATTGCTAAATCAGCTCAG
TTGCGAGTAGAGTGCCAAAATAGAGAGTAGCGACAACGAAAACAAGTTTT
TGTGGATGGTGAGAAAGTAAAAACAATAGCAAATTTATATATATAGCTAT
ATATATATGTGGTAAGGTGCTGTAAGCATTTAAAAATACAAATCCTCTCG
AGGTTTTAATGGCCAAAGTTTCGTAAACGTGTAAATTGAGTGGAATTCGA
TTGCGAGTGCATTCTTGGTTTGTTTTGAGTGAGAACCGAAAACCAGTTTA
CACCGTGCTTCTTGCCAAGTTGAATCCGGTTTAATCTCGGCTTGAGTCAT
CCTTTAGTTTATACTGACTGTGTTTATCAGTTCAATGTGATCCGCCAGTG
AAGCTGCATCAGAACGAGTAACTCATTCCAGGACCTGGAATCCACTGCCA
CCATGTTGCCGGTAATCCTCATAGCCTGCCTGGCCCAGCTGGTACTGGCT
CAGGCGGATCTTAAAGATCTGGATGGACCCAATATCTGCAAAAGAAGAGA
ACTATATAACGTAGACGTTGTCTACACAGAACTGCAATCGTTCCAGGAAC
GGGGCTCCACCTGGTGCGTCACATTCCCGCCGAGGTGCTCCACCTATCGC
ATTAAACACCGAGTGGTCAACAAAACCAAGACGATTGCAAAGAACCGTAT
TGTGAGGGACTGTTGTGATGGCTACATCGCGAGCGCAGGAGAATGCGTGC
CGCATTGTTCGGAACCCTGCCAGCACGGTAGATGCATCTCCCCGGAGAAG
TGCAAGTGTGATCATGGTTACGGAGGACCCGCCTGCGATATAATTTGCAG
ATGCCTGAATAACTCCTCCTGCGACCCCGATTCCGGTAACTGCATCTGCT
CAGCCGGTTGGACTGGCGCCGACTGTGCGGAACCCTGCCCACCTGGATTC
TACGGCATGGAATGCAAGGAACGGTGCCCGGAGATCCTCCATGGCAACAA
GAGCTGCGATCACATCACAGGTGAAATTCTCTGCCGCACGGGTTACATAG
GTCTCACCTGCGAGCACCCATGTCCTGCTGGACTCTACGGACCCGGCTGC
AAGCTCAAGTGCAATTGCGAGCACGGCGGCGAGTGCAACCACGTTACAGG
CCAGTGCCAGTGCCTGCCAGGGTGGACAGGTTCCAACTGCAACGAGTCCT
GTCCCACAGACACCTACGGACAAGGATGCGCCCAGCGGTGCCGCTGCGTG
CACCACAAGGTTTGCCGCAAGGCCGACGGTATGTGCATCTGCGAAACCGG
CTGGTCGGGCACCCGGTGCGATGAGGTCTGTCCGGAGGGATTCTACGGCG
AGCACTGCATGAATACCTGTGCCTGTCCGTCGGCCAATTTCCAGTGCCAT
GCGGCCCACGGTTGTGTGTGCAGGAGTGGCTACACCGGCGATAACTGCGA
CGAGCTAATCGCCTCTCAACGTATTGCAGACCAAAGCGAAAATTCGAGCC
GGGCGAGTGTAGCTCTGACCTTAGTCCTGATGACCCTGTTTGCGTGCATA
ATCTTCGCAGTGTTCATTTACTACCGCCGACGTGTGTCCAATCTAAAAAC
CGAAATCGCCCATGTACACTACACCCATGATACGAATCCCCCGAGCTGGC
CGCCCAACCACAACTTCGACAATCCCGTGTACGGCATGCAGGCGGAAACG
CGTCTCCTGCCCAACAATATGCGTTCCAAGATGAACAACTTTGACCAGAG
GAGCACGATGAGCACGGACTACGGCGATGACTGCAATGCCAGTGGCAGGG
TGGGTAGCTATTCGATCAACTACAACCACGACCTGCTAACGAAGAACTTG
AACGCGGACCGGACCAATCCGATTGTGTACAACGAATCCCTCAAAGAGGA
GCATGTCTACGACGAGATCAAGCACAAGGAGGGCTACAAGGATCCCGTGA
AAATATATAGCAAGATTTTGTTTCCCGAGGATGAATACGATCACCTGGAC
TACTCACGACCCAGCACCTCGCAGAAGCCGCACTACCACCGCATGAACGA
CGCCATGCTCAACATCAACCAGGACGAGGAGAAGCCCAGCAACGTGAAGA
ACATGACTGTGCTGCTGAACAAACCGCTGCCGCCCACGGAACCGGAGCCA
CAACACGAGTGCTTCGACAACACGAACACCAACCTGGACAACGTGTCGAC
GGCGTCGCCTAGTTCCAGTCCGAAATTTCTAAAGTAGGCAGCCGGAACAG
TCACTTCACCCGGTGGTTAGATCTTAAGCCATGATATTTTAATTTGTCTA
TGTATGTAGGGTAAGAATTGCCCAACTGGTACGTAAGTTTAAGTTGTTTC
CTAGAACTTCAGTTCATGCTGTTATGTATTTCTGTGTAGCGTAGCATTTG
TCTTGCATTCGATATGTAATTGTAGTTTTCTTGTAGTTCTTGCTCAACAA
AGCCATGTCAGCTCAACCAATTGTAAATTATTATTTAGGGGCCCTTTACA
ACCCAGCAACGGTCCTCACTTTTGTAAATGTCTCCTTCATTCGACCCAAA
TTGTGCTAACATTTATGCTCATATAGGCGACTAACTCCCTAAGTGAAATC
ATATTAAATTAAGTACCTACAACACCTCTTCCTGGTAAAATTGCAGAGTG
CCTGTGAGACAAACTCGGATCGGAGGTTGCAATAATTTTAAATCGAACCC
ATGCATATACAGATTGAAATCAATAGCTTAAGTATATGGTATTTATATTT
TTAATAAGAAACTTATTTTTAGAGTGCATAAACAATACATTTATAGAGAT
CATTAAAAAAAAATAAAAAATTAGTTCAAATATTGGAACGTTAACCCATT
TATAACTACCCTGAAAATCGTTATGTTATCTTCATATACACATATCAATT
CTGAGTGAAACGTGTATAATAAAATGAATAATACAAATATGTAAAAAAAA
AAAAAAAAAA

FI03750.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
drpr-RA 3207 drpr-RA 14..3206 1..3193 15965 100 Plus
drpr-RB 4401 drpr-RB 2444..3554 1087..2197 5525 99.8 Plus
drpr-RB 4401 drpr-RB 14..1111 1..1098 5475 99.9 Plus
drpr-RB 4401 drpr-RB 3554..4401 2230..3077 4240 100 Plus
Oseg4.a 4299 Oseg4.a 4034..4299 1..266 1330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1715155..1716117 3192..2230 4815 100 Minus
chr3L 24539361 chr3L 1730081..1730653 573..1 2850 99.8 Minus
chr3L 24539361 chr3L 1716939..1717440 1744..1243 2510 100 Minus
chr3L 24539361 chr3L 1716563..1716868 2050..1745 1530 100 Minus
chr3L 24539361 chr3L 1723552..1723787 803..568 1180 100 Minus
chr3L 24539361 chr3L 1723330..1723493 967..804 820 100 Minus
chr3L 24539361 chr3L 1717506..1717663 1244..1087 760 98.7 Minus
chr3L 24539361 chr3L 1716357..1716504 2197..2050 740 100 Minus
chr3L 24539361 chr3L 1723140..1723266 1093..967 635 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
drpr-RA 1785 CG2086-PA 1..1785 703..2487 8925 100 Plus
drpr-RC 1587 CG2086-PC 1..1495 703..2197 7475 100 Plus
drpr-RE 3129 CG2086-PE 1729..3129 1087..2487 6975 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:32 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
drpr-RA 3206 CG2086-RA 15..3206 1..3192 15960 100 Plus
drpr-RC 3298 CG2086-RC 15..2211 1..2197 10985 100 Plus
drpr-RE 4435 CG2086-RE 2445..4435 1087..3077 9925 99.9 Plus
drpr-RC 3298 CG2086-RC 2451..3298 2230..3077 4240 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
drpr-PA 594 CG2086-PA 1..594 703..2484 3379 100 Plus
drpr-PD 613 CG2086-PD 1..613 703..2484 3348 96.7 Plus
drpr-PC 528 CG2086-PC 1..498 703..2196 2860 100 Plus
drpr-PE 1042 CG2086-PE 521..1042 883..2484 2698 90.3 Plus
drpr-PB 1031 CG2086-PB 521..1031 883..2484 2621 88.2 Plus
drpr-PE 1042 CG2086-PE 1..347 703..1710 1211 62.3 Plus
drpr-PE 1042 CG2086-PE 274..519 994..1701 528 38.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1715590..1716557 3197..2230 4825 99.9 Minus
3L 28110227 3L 1730521..1731093 573..1 2850 99.8 Minus
3L 28110227 3L 1717379..1717880 1744..1243 2510 100 Minus
3L 28110227 3L 1717003..1717308 2050..1745 1530 100 Minus
3L 28110227 3L 1723992..1724227 803..568 1180 100 Minus
3L 28110227 3L 1723770..1723933 967..804 820 100 Minus
3L 28110227 3L 1717946..1718103 1244..1087 760 98.7 Minus
3L 28110227 3L 1716797..1716944 2197..2050 740 100 Minus
3L 28110227 3L 1723580..1723706 1093..967 635 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1715590..1716557 3197..2230 4825 99.8 Minus
3L 28103327 3L 1730521..1731093 573..1 2850 99.8 Minus
3L 28103327 3L 1717379..1717880 1744..1243 2510 100 Minus
3L 28103327 3L 1717003..1717308 2050..1745 1530 100 Minus
3L 28103327 3L 1723992..1724227 803..568 1180 100 Minus
3L 28103327 3L 1723770..1723933 967..804 820 100 Minus
3L 28103327 3L 1717946..1718103 1244..1087 760 98.7 Minus
3L 28103327 3L 1716797..1716944 2197..2050 740 100 Minus
3L 28103327 3L 1723580..1723706 1093..967 635 100 Minus
3L 28103327 3L 1716675..1716708 2230..2197 170 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:13:01 has no hits.

FI03750.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:07:44 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1730085..1730653 1..569 100   Minus
chr3L 1723552..1723785 570..803 100 <- Minus
chr3L 1723330..1723493 804..967 100 <- Minus
chr3L 1723140..1723265 968..1093 100 <- Minus
chr3L 1717507..1717656 1094..1243 100 <- Minus
chr3L 1716939..1717439 1244..1744 100 <- Minus
chr3L 1716563..1716868 1745..2050 100 <- Minus
chr3L 1716357..1716503 2051..2197 100 <- Minus
chr3L 1716235..1716267 2198..2230 100 <- Minus
chr3L 1715155..1716116 2231..3192 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:51:19 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 1..1785 703..2487 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:11 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 1..1785 703..2487 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:14 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 1..1785 703..2487 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:36 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 1..1785 703..2487 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:44 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 1..1785 703..2487 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:51:19 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 1..3192 1..3192 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:11 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 1..3192 1..3192 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:14 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 15..3206 1..3192 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:36 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 1..3192 1..3192 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:44 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
drpr-RA 15..3206 1..3192 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:44 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1730525..1731093 1..569 100   Minus
3L 1723992..1724225 570..803 100 <- Minus
3L 1723770..1723933 804..967 100 <- Minus
3L 1723580..1723705 968..1093 100 <- Minus
3L 1717947..1718096 1094..1243 100 <- Minus
3L 1717379..1717879 1244..1744 100 <- Minus
3L 1717003..1717308 1745..2050 100 <- Minus
3L 1716797..1716943 2051..2197 100 <- Minus
3L 1716675..1716707 2198..2230 100 <- Minus
3L 1715595..1716556 2231..3192 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:14 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1730525..1731093 1..569 100   Minus
arm_3L 1723992..1724225 570..803 100 <- Minus
arm_3L 1723770..1723933 804..967 100 <- Minus
arm_3L 1723580..1723705 968..1093 100 <- Minus
arm_3L 1717947..1718096 1094..1243 100 <- Minus
arm_3L 1717379..1717879 1244..1744 100 <- Minus
arm_3L 1717003..1717308 1745..2050 100 <- Minus
arm_3L 1716797..1716943 2051..2197 100 <- Minus
arm_3L 1716675..1716707 2198..2230 100 <- Minus
arm_3L 1715595..1716556 2231..3192 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:05 Download gff for FI03750.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1730525..1731093 1..569 100   Minus
3L 1723992..1724225 570..803 100 <- Minus
3L 1723770..1723933 804..967 100 <- Minus
3L 1723580..1723705 968..1093 100 <- Minus
3L 1717947..1718096 1094..1243 100 <- Minus
3L 1717379..1717879 1244..1744 100 <- Minus
3L 1717003..1717308 1745..2050 100 <- Minus
3L 1716797..1716943 2051..2197 100 <- Minus
3L 1716675..1716707 2198..2230 100 <- Minus
3L 1715595..1716556 2231..3192 100 <- Minus

FI03750.pep Sequence

Translation from 702 to 2486

> FI03750.pep
MLPVILIACLAQLVLAQADLKDLDGPNICKRRELYNVDVVYTELQSFQER
GSTWCVTFPPRCSTYRIKHRVVNKTKTIAKNRIVRDCCDGYIASAGECVP
HCSEPCQHGRCISPEKCKCDHGYGGPACDIICRCLNNSSCDPDSGNCICS
AGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIG
LTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESC
PTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGE
HCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDELIASQRIADQSENSSR
ASVALTLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTHDTNPPSWP
PNHNFDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNASGRV
GSYSINYNHDLLTKNLNADRTNPIVYNESLKEEHVYDEIKHKEGYKDPVK
IYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKPSNVKN
MTVLLNKPLPPTEPEPQHECFDNTNTNLDNVSTASPSSSPKFLK*

FI03750.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24971-PA 902 GF24971-PA 425..902 119..594 2273 91.8 Plus
Dana\GF24969-PA 137 GF24969-PA 1..130 1..130 555 73.8 Plus
Dana\GF24971-PA 902 GF24971-PA 1..205 130..336 379 41.1 Plus
Dana\GF24971-PA 902 GF24971-PA 21..292 75..334 346 36.2 Plus
Dana\GF24971-PA 902 GF24971-PA 212..437 125..335 345 36.8 Plus
Dana\GF24971-PA 902 GF24971-PA 139..402 105..358 339 33.2 Plus
Dana\GF14272-PA 566 GF14272-PA 44..217 20..175 320 39.1 Plus
Dana\GF10909-PA 3720 GF10909-PA 403..616 117..332 191 30.3 Plus
Dana\GF21809-PA 1788 GF21809-PA 962..1188 117..302 183 31.5 Plus
Dana\GF10909-PA 3720 GF10909-PA 481..713 118..334 165 31.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:54:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14570-PA 899 GG14570-PA 379..899 61..594 2393 85.8 Plus
Dere\GG14568-PA 136 GG14568-PA 1..131 1..130 634 91.6 Plus
Dere\GG14570-PA 899 GG14570-PA 1..205 130..336 396 42.8 Plus
Dere\GG14570-PA 899 GG14570-PA 139..388 105..344 382 36.7 Plus
Dere\GG14570-PA 899 GG14570-PA 18..261 117..346 368 36.6 Plus
Dere\GG14570-PA 899 GG14570-PA 21..292 75..334 355 36.5 Plus
Dere\GG14570-PA 899 GG14570-PA 229..437 140..335 350 39.3 Plus
Dere\GG14069-PA 3725 GG14069-PA 403..616 132..332 190 31.1 Plus
Dere\GG18889-PA 542 GG18889-PA 81..275 99..336 189 32.2 Plus
Dere\GG10498-PA 1786 GG10498-PA 960..1186 117..302 187 31.5 Plus
Dere\GG14069-PA 3725 GG14069-PA 1828..2266 106..489 161 26.5 Plus
Dere\GG14069-PA 3725 GG14069-PA 481..713 118..334 158 30.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15511-PA 1050 GH15511-PA 554..1050 109..594 1906 74.2 Plus
Dgri\GH15511-PA 1050 GH15511-PA 25..351 20..336 799 49.1 Plus
Dgri\GH15511-PA 1050 GH15511-PA 358..568 125..333 367 38 Plus
Dgri\GH15511-PA 1050 GH15511-PA 286..524 105..334 343 36.9 Plus
Dgri\GH16286-PA 3702 GH16286-PA 418..620 140..333 212 33 Plus
Dgri\GH11139-PA 3664 GH11139-PA 1474..1685 115..308 189 31 Plus
Dgri\GH15511-PA 1050 GH15511-PA 121..237 234..350 182 35.9 Plus
Dgri\GH10705-PA 3589 GH10705-PA 2223..2531 103..348 177 26.9 Plus
Dgri\GH17601-PA 505 GH17601-PA 64..258 99..336 173 31.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
drpr-PA 594 CG2086-PA 1..594 1..594 3379 100 Plus
drpr-PD 613 CG2086-PD 1..613 1..594 3348 96.7 Plus
drpr-PC 528 CG2086-PC 1..498 1..498 2860 100 Plus
drpr-PE 1042 CG2086-PE 521..1042 61..594 2698 90.3 Plus
drpr-PB 1031 CG2086-PB 521..1031 61..594 2621 88.2 Plus
drpr-PE 1042 CG2086-PE 1..347 1..336 1211 62.3 Plus
drpr-PE 1042 CG2086-PE 274..519 98..333 528 38.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16787-PA 1045 GI16787-PA 555..1030 109..577 1886 73.3 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 18..352 12..336 792 47 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 484..734 119..359 382 35.5 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 325..586 106..350 379 34.8 Plus
Dmoj\GI12658-PA 619 GI12658-PA 60..238 27..191 305 38 Plus
Dmoj\GI13230-PA 974 GI13230-PA 418..620 140..333 187 32.1 Plus
Dmoj\GI11276-PA 3585 GI11276-PA 2219..2517 103..333 186 27.2 Plus
Dmoj\GI12813-PA 3365 GI12813-PA 1206..1387 140..308 181 32.3 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 122..238 234..350 178 34.2 Plus
Dmoj\GI13230-PA 974 GI13230-PA 490..715 123..334 163 33 Plus
Dmoj\GI12658-PA 619 GI12658-PA 154..237 235..320 158 37.2 Plus
Dmoj\GI13230-PA 974 GI13230-PA 417..664 101..333 155 30.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11918-PA 739 GL11918-PA 270..739 105..594 1182 55.1 Plus
Dper\GL11918-PA 739 GL11918-PA 1..339 1..339 919 53.4 Plus
Dper\GL11877-PA 627 GL11877-PA 1..121 1..119 476 71.1 Plus
Dper\GL21423-PA 215 GL21423-PA 1..103 1..118 348 56.7 Plus
Dper\GL22528-PA 3708 GL22528-PA 414..616 140..332 195 32.2 Plus
Dper\GL18321-PA 558 GL18321-PA 84..318 99..333 180 32.3 Plus
Dper\GL22528-PA 3708 GL22528-PA 1830..2097 106..333 163 33.7 Plus
Dper\GL22528-PA 3708 GL22528-PA 481..713 118..334 157 30.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23962-PA 880 GA23962-PA 368..880 94..594 2131 82.4 Plus
Dpse\GA23961-PA 146 GA23961-PA 1..132 1..130 528 74.2 Plus
Dpse\GA23962-PA 880 GA23962-PA 1..208 130..339 375 39.5 Plus
Dpse\GA23962-PA 880 GA23962-PA 17..247 116..332 372 36.9 Plus
Dpse\GA23962-PA 880 GA23962-PA 139..388 105..344 359 36.3 Plus
Dpse\GA23962-PA 880 GA23962-PA 60..292 116..334 342 38.1 Plus
Dpse\GA23962-PA 880 GA23962-PA 206..416 119..327 337 36.2 Plus
Dpse\GA28782-PA 571 GA28782-PA 44..244 20..205 330 37.7 Plus
Dpse\GA13884-PA 569 GA13884-PA 84..279 99..337 196 32.2 Plus
Dpse\GA10179-PA 3708 GA10179-PA 414..616 140..332 195 32.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14179-PA 900 GM14179-PA 379..900 61..594 2481 88.6 Plus
Dsec\GM14177-PA 135 GM14177-PA 1..130 1..130 683 98.5 Plus
Dsec\GM14179-PA 900 GM14179-PA 1..205 130..336 390 42.3 Plus
Dsec\GM14179-PA 900 GM14179-PA 139..386 105..342 384 36.9 Plus
Dsec\GM14179-PA 900 GM14179-PA 337..554 119..334 373 37.6 Plus
Dsec\GM14179-PA 900 GM14179-PA 18..247 117..332 358 37.1 Plus
Dsec\GM14179-PA 900 GM14179-PA 60..292 116..334 340 38.1 Plus
Dsec\GM13851-PA 3694 GM13851-PA 386..599 132..332 190 31.1 Plus
Dsec\GM16587-PA 1781 GM16587-PA 953..1179 117..302 186 31.5 Plus
Dsec\GM15516-PA 2682 GM15516-PA 326..632 101..333 180 29.5 Plus
Dsec\GM13851-PA 3694 GM13851-PA 464..696 118..334 160 30.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13447-PA 938 GD13447-PA 409..583 116..296 853 89 Plus
Dsim\GD13447-PA 938 GD13447-PA 803..938 459..594 701 97.1 Plus
Dsim\GD13445-PA 135 GD13445-PA 1..130 1..130 683 98.5 Plus
Dsim\GD13447-PA 938 GD13447-PA 1..205 130..336 381 42.3 Plus
Dsim\GD13447-PA 938 GD13447-PA 139..386 105..342 376 37.3 Plus
Dsim\GD13447-PA 938 GD13447-PA 18..261 117..346 349 35.8 Plus
Dsim\GD13447-PA 938 GD13447-PA 337..579 119..335 334 34.8 Plus
Dsim\GD13447-PA 938 GD13447-PA 60..292 116..334 329 37.7 Plus
Dsim\GD23490-PA 1788 GD23490-PA 960..1186 117..302 181 31 Plus
Dsim\GD23941-PA 421 GD23941-PA 7..91 194..279 168 41.9 Plus
Dsim\GD16007-PA 554 GD16007-PA 81..308 99..333 167 31.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12529-PA 1051 GJ12529-PA 558..1037 109..580 1883 76 Plus
Dvir\GJ12529-PA 1051 GJ12529-PA 21..367 17..346 787 47.1 Plus
Dvir\GJ12529-PA 1051 GJ12529-PA 362..572 125..333 374 39.9 Plus
Dvir\GJ12529-PA 1051 GJ12529-PA 290..528 105..334 365 38.2 Plus
Dvir\GJ12529-PA 1051 GJ12529-PA 211..501 116..350 320 30 Plus
Dvir\GJ18159-PA 616 GJ18159-PA 59..251 27..205 312 36.9 Plus
Dvir\GJ12003-PA 3723 GJ12003-PA 407..620 117..333 203 31 Plus
Dvir\GJ15946-PA 508 GJ15946-PA 80..275 99..337 188 31.4 Plus
Dvir\GJ18176-PA 3383 GJ18176-PA 1194..1405 115..308 186 31 Plus
Dvir\GJ12529-PA 1051 GJ12529-PA 125..241 234..350 178 34.2 Plus
Dvir\GJ18159-PA 616 GJ18159-PA 153..253 235..336 165 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17064-PA 892 GK17064-PA 409..892 116..594 1967 78.4 Plus
Dwil\GK17063-PA 658 GK17063-PA 1..139 1..136 531 68.3 Plus
Dwil\GK17064-PA 892 GK17064-PA 1..204 130..336 397 41.1 Plus
Dwil\GK17064-PA 892 GK17064-PA 39..262 125..348 378 38.8 Plus
Dwil\GK17064-PA 892 GK17064-PA 60..293 116..335 365 38.4 Plus
Dwil\GK17064-PA 892 GK17064-PA 211..445 125..332 350 34.3 Plus
Dwil\GK17064-PA 892 GK17064-PA 138..378 105..334 341 36.4 Plus
Dwil\GK17256-PA 3709 GK17256-PA 414..616 140..332 181 31.7 Plus
Dwil\GK19901-PA 539 GK19901-PA 79..313 99..333 178 29.7 Plus
Dwil\GK17256-PA 3709 GK17256-PA 464..713 113..334 175 30.6 Plus
Dwil\GK15022-PA 420 GK15022-PA 5..89 235..320 166 37.2 Plus
Dwil\GK17256-PA 3709 GK17256-PA 1804..2088 88..333 164 32.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20925-PA 900 GE20925-PA 379..900 61..594 2392 85.4 Plus
Dyak\GE20922-PA 135 GE20922-PA 1..130 1..130 682 98.5 Plus
Dyak\GE20925-PA 900 GE20925-PA 1..205 130..336 389 42.3 Plus
Dyak\GE20925-PA 900 GE20925-PA 139..402 105..358 387 35.5 Plus
Dyak\GE20925-PA 900 GE20925-PA 337..553 119..333 384 38.2 Plus
Dyak\GE20925-PA 900 GE20925-PA 18..247 117..332 349 36.6 Plus
Dyak\GE20925-PA 900 GE20925-PA 60..292 116..334 337 37.7 Plus
Dyak\GE20494-PA 3710 GE20494-PA 403..616 132..332 192 32 Plus
Dyak\GE17331-PA 556 GE17331-PA 81..275 99..336 189 32.2 Plus
Dyak\GE14631-PA 1788 GE14631-PA 960..1186 117..302 181 31 Plus
Dyak\GE20494-PA 3710 GE20494-PA 481..713 118..334 158 30.5 Plus

FI03750.hyp Sequence

Translation from 702 to 2486

> FI03750.hyp
MLPVILIACLAQLVLAQADLKDLDGPNICKRRELYNVDVVYTELQSFQER
GSTWCVTFPPRCSTYRIKHRVVNKTKTIAKNRIVRDCCDGYIASAGECVP
HCSEPCQHGRCISPEKCKCDHGYGGPACDIICRCLNNSSCDPDSGNCICS
AGWTGADCAEPCPPGFYGMECKERCPEILHGNKSCDHITGEILCRTGYIG
LTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESC
PTDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGE
HCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDELIASQRIADQSENSSR
ASVALTLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTHDTNPPSWP
PNHNFDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNASGRV
GSYSINYNHDLLTKNLNADRTNPIVYNESLKEEHVYDEIKHKEGYKDPVK
IYSKILFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKPSNVKN
MTVLLNKPLPPTEPEPQHECFDNTNTNLDNVSTASPSSSPKFLK*

FI03750.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
drpr-PA 594 CG2086-PA 1..594 1..594 3379 100 Plus
drpr-PD 613 CG2086-PD 1..613 1..594 3348 96.7 Plus
drpr-PC 528 CG2086-PC 1..498 1..498 2860 100 Plus
drpr-PE 1042 CG2086-PE 521..1042 61..594 2698 90.3 Plus
drpr-PB 1031 CG2086-PB 521..1031 61..594 2621 88.2 Plus
drpr-PE 1042 CG2086-PE 1..347 1..336 1211 62.3 Plus
drpr-PE 1042 CG2086-PE 274..519 98..333 528 38.1 Plus