Clone FI03833 Report

Search the DGRC for FI03833

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:38
Well:33
Vector:pOT2
Associated Gene/TranscriptCG17386-RA
Protein status:FI03833.pep: gold
Sequenced Size:4272

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17386 2008-08-15 Release 5.9 accounting
CG17386 2008-12-18 5.12 accounting

Clone Sequence Records

FI03833.complete Sequence

4272 bp assembled on 2008-07-17

GenBank Submission: BT044172.1

> FI03833.complete
CAGCGTTGCATGAACTCAATTTAGTCGCGTGCGAAACAGAAAGTTTACAC
AAGTTCAACCGAATAGCCTTACGGAAATACATAGGAAACGGGCAACAACA
ACTAACAACCAACAAGCTGAAACAAGCAGCAGCAACAACTTGAACTCGAA
AATTACCCAAAACGCAGACAAAATTGTTAATTGAACTTTTATTTATTAAC
TTTTTGGCGAATCGGTGTCAAGCGCGGCCTAGAAAAAGAAATAAAACAAA
AACCCAGGCGACCAAACGCCCCAAACAAATTCCAAGCACGTTGCAGGCGA
TATTACGCAAACGACGGTATAAAAAAACACCAGCAACTGCTGCAACTAAC
TACACCAGCAACACCAACATTACCAACCAGCAACAGCTGACGTTCAATGA
ACGCTTCAGTTTGGGTTTCAGGTTACCCAGATGCACATCTTGGCTAATCG
GGCCCATCCGATGTAAGGTGCAGCTCCCGCAGCGAGCTTTTCCCCACTGA
ACTTGAAAGTGAAAGTGAACGAGAGAGAGAGAGAGAGAAGGAGAAGGAGA
AAGGGAGCGGAGAAATTGGAAAGAATTACACTTGGCTTGGCCAGCAACTA
TTGAGAGTAAAGCCGAAAGAAGGAAAGACAGCTTTTCGCTTTTGCTGGAG
TGCCCAAGAAACATCTCAGAGCATCAGCCAAGGTCGTTCGTTGTAACCAT
GAGCAGTCCCAGGGATAAGGCGGAGCAGGTGTACGAGGTGAAGGCTCCAC
ATGCCGGTGCAGAGGGTCACACGTTCCTTGTGAGTCCCGTGGACCCCACT
CCGATCCTAGCGCCCATTCTCACCGCTGTGCCTGTGATGAAAGCACCGGA
TTCGCCTGCTTCAATGGACAAGACCAAGGAGATGGAGGAGCTGGATGATG
AGCAGCCGAGCTGCAGTTCCCAGGCGGTGGTGCCGTTGTCCTCATCGCTG
CCCTGCAAGCTGCTCCGCATGCATGCCAGACGCTCGGCCCAGGCGCTGCT
CCACCAAATGGAATCGATGGACTCTCAGCTGGGCAGCAGCAATGGCAGCA
CCTCGGAGGATACTTCACCCTCTGCTCCGCCCATGTCGCCCACTGACCAC
CAACTGGTGGATGTGGGCATGGGTTCCTCCATTGGGGACTCGGATGAATC
GTCGGAAGAGGGTGATGAGCTGAAGCCCCTGGCCGTGGACAATCACATCA
TAGCCGAGGTGGACCTAACCGAGCGCCAGACTACGCCACCGGCCGTCTTG
AGTGAGGCGAATTTGGAGAAGTTCCGTAAGCACCAGATGGATAACATCTA
TCTACATCCTAACTTCACTCTGGATGCTTCTCCACCTCCGGCGGTCGCAC
CAGCCAACTCACCCGTTCTGGAGGCCAAGAGAACCCATCGTTCGTTCCTC
ACCATGAAGAAGGAAAAGGAGGTGGAGCCGCCGCAAGAGAAGGAGCAGGA
AGTGCCGGTACACCAGGAACAGGATACTGAGCCCCAAGGACCCAATGAGA
TAGACACACTAGATCCCTCACTCATTCCCAGCGAGGAACTGGCAGCCGAA
ATCACCGATGCCGTGGAGTTCTACTTCTCCAATGAGAGCATCCTGAAGGA
TGCATTCCTGCTGAAACATGTGCGACGCAACAAGGAGGGTTTCGTCAGCC
TTAAACTGGTGTCCAGCTTCAAGAGGGTGCGCCAACTGACCAGGGAGTGG
AAGGTGGTTGGAGATGCAGTGCGTCGCAAGTCCCGCAAGATCGAGCTGAA
TGATGTGGGCACCAAGGTGCGCAGAATCGAACCGCTGCCCAGTTTCGATG
AAACCATGCCCTCTCGCACGATCGTTGCCTGTGATCTGCCACTGGACAAG
CTAACCATCGAAAAGGTATCGGATCTATTCTCGCCATGCGGAGAGATTGC
CCTCATACGCATTCTCAAGCCCGGAATGGCCATTCCCGTGGATGTGCGTC
AGTTCATGAACAAGTATCCAGAACTGCAGCAAAAGGAGTGTGCTCTAGTG
GAGTACTTAGAATCCTCTTCCGCCAGGGATGCCCGTCATCTGAATGGCCC
CTTTCAGGTCTACGAGATGGTGGCGCCCAAGAAAAAGACCGGCAAGAAGG
CAGCCGTCATCCAGATCGCCGCTCCGGTGGCCCGGATGGTGGAGAATTAT
CGCTACTACAACGATGCCAACTACGAGCGGAGTCGAGGTGGCAGCTTCTC
CGGCCACGAAACTGTACCGGATCTGCGCTTCAAACTCAAGCGCAACAACT
CGGACTTCCAGCCCAGTTACTACCAACAAACGGGGCCCAGCTACCATGCC
AATCCGTATCAGCATTATCAGCCCCGTGGGAGCATTGGCAACCAGAACCA
GGAGGTGGGTCCCAATGGTTTTTTCGGCTATGGTCCCAGGCGATACAGCA
ACACATCGACAATTTCGGCCAACACAGCGGCCGCCTTGGGCGATGTTTCG
CCTATATCTTCTGCTGTCAATTCAGGCGGTAATCCGATGGTGTCTGGTAT
AAGCAGTCTGCAGCGCCGTCTGTCCAACTGCTCCGAGCAGAACTACACTC
CAGAAGTCAATCCTTCGATGTCACGAAGGGCCAGCAATTGCTCGGAAACG
GGAGGAGTTCCCCAACGTCGCGATTCGAACTGTTCGGAGAGTTGTCCATG
CTCCCGAAGGGTCTCGGACTTTGCTCAGACGACAGACACTAGTTACAGAA
AGACCTCGGTGTGTTCGAATGGCAGCTGTCCGGGCAATAATCAGAACCAG
GAGCGTCGCTTCTCCAACGGATCCATGCAGTTCGAGCGAACCTTCTCGAA
TGCCAGCGAGAGCAGTGGCTTCTATCGTCGCCCGTCGAACGATTTCAATA
TCGAGCGGGAGCCCATCCAAACCGATCAGCTGGTGGGTGGAGGAGGCGGT
GGCTACCAGGTGTGGCCACGTCGTTACTCCAACAACTTCCAGCAGCTGAG
CAGCAAGCTGGCGGCATATGATAATGCTCAGTATATCGGAGGAAGACGTA
TATCCACGGACTCGGGATACGATCGTCGCTGCTCGTTTGGATCGGAAGGC
TTCGAAGGATCTCCACGATCTCGCACCGGTAGCTTCCTGAGCAACTACAA
GCACGGCGGCGGCGATGGCTACGATGGCCAGCCAAGATCCCGAACCGGTA
GCTTCCTCGACGGATCTCCTCGGTCGCGTTCCGGTTCGTTTGCCCAGCGA
GCTGCCGAGAGCCTGGTGCGCACTCCAATGGGTCCAGATGGTAGCAAGGG
ATTCGGCCAGAGGGCCAGGAAATTCGGACAGACCATATCGCCCGTAAATT
AGAATGAATGGGGGGGCACATTGTTGATTAATTTTAGTGGGAAGATAGTA
GTACTCTGTTATAGAACTCCGTTTTAGAACGGCTAATCGTATGTGAAATT
AATGGCTGTACACTGTGATGCTGTTCAATTTGTTAAATGTCCCACACATA
CACCCCCAATACACTGTAGCCCAACCTAGGTTAGGAACAGATACCTATAG
TTAACGAATTTTTATTACCGAATTTTCCGAGTGGTTTCGTTGGATCATGT
GAAACTCTGCCAGCCCTTCATTCATTTACTTTTCTACAACTTTCTTATAT
GAAACATGACGATAACAATCACTGCCAATAGCTTAAGGAATACAAAACAG
AGATTTAATTGGTTTGGTAGACACTTAAGATTATACTTAATCAATATATA
TGATTGACCATTAACCAGTTAATAGATTGTAGGTTAATATACTTCAATGT
TGTGTTTTTGAAAAACTATAGAAATAGAATACGGGCCCAACTATTATCAC
AAAGTCTCACATGACTTCGATATATATTTATATATATATATGCCTAGATA
TATTCCCATGAGTTCACAAATTATTCCTGGCGACTTTTATGCAGTTTTAG
TATTCTTTTATTGCCTATAAACATTTTTATTTAGCTTGCAATTAGGTTAG
ATATAGGATAGTCACACCCATAACTCAGACGGCTGCCATAAAAATCAGTT
ATAGAATTGCGGCCATACGAAACCAGATGTGAGTAATACGAATATAATTC
GGATTGTAATCAAGGAAAATTGAATTAGATTCTCAGGTCATTAGGTTTAA
CATTCGAGGGGCAGGCAAAAGGTGATTTTCACATTTTCCACCCAATTCAC
TCGCAATTTTCGCACGTTTTTCTTTTATTTGTTTTTTATTTTCCACACTT
TTATTAGCCTAATATTTACATATTTAGATGTAGGAAACTTGGTTGTCCTC
CCGCAAAAAAAAAAAAAAAAAA

FI03833.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG17386-RA 4254 CG17386-RA 1..4254 1..4254 21270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10307649..10311905 1..4254 20885 99.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG17386-RB 2604 CG17386-PB 1..2604 699..3302 13020 100 Plus
CG17386-RA 2604 CG17386-PA 1..2604 699..3302 13020 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:38 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG17386-RB 4441 CG17386-RB 18..4271 1..4254 21270 100 Plus
CG17386-RA 4271 CG17386-RA 18..4271 1..4254 21270 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG17386-PB 867 CG17386-PB 1..867 699..3299 4088 100 Plus
CG17386-PA 867 CG17386-PA 1..867 699..3299 4088 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14420341..14424608 1..4268 21325 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14421540..14425807 1..4268 21325 99.9 Plus
Blast to na_te.dros performed on 2014-11-27 11:16:44 has no hits.

FI03833.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:21:56 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10307649..10311905 1..4254 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:46:28 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 1..2604 699..3302 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:12 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 1..2604 699..3302 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:06 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 1..2604 699..3302 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:37 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 1..2604 699..3302 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:21:56 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 1..2604 699..3302 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:29:34 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 1..2609 699..3307 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:12 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 1..4254 1..4254 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:06 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 18..4271 1..4254 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:37 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 1..2609 699..3307 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:21:56 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
CG17386-RA 18..4271 1..4254 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:21:56 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14420341..14424594 1..4254 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:06 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10307846..10312099 1..4254 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:07 Download gff for FI03833.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14421540..14425793 1..4254 100   Plus

FI03833.pep Sequence

Translation from 698 to 3301

> FI03833.pep
MSSPRDKAEQVYEVKAPHAGAEGHTFLVSPVDPTPILAPILTAVPVMKAP
DSPASMDKTKEMEELDDEQPSCSSQAVVPLSSSLPCKLLRMHARRSAQAL
LHQMESMDSQLGSSNGSTSEDTSPSAPPMSPTDHQLVDVGMGSSIGDSDE
SSEEGDELKPLAVDNHIIAEVDLTERQTTPPAVLSEANLEKFRKHQMDNI
YLHPNFTLDASPPPAVAPANSPVLEAKRTHRSFLTMKKEKEVEPPQEKEQ
EVPVHQEQDTEPQGPNEIDTLDPSLIPSEELAAEITDAVEFYFSNESILK
DAFLLKHVRRNKEGFVSLKLVSSFKRVRQLTREWKVVGDAVRRKSRKIEL
NDVGTKVRRIEPLPSFDETMPSRTIVACDLPLDKLTIEKVSDLFSPCGEI
ALIRILKPGMAIPVDVRQFMNKYPELQQKECALVEYLESSSARDARHLNG
PFQVYEMVAPKKKTGKKAAVIQIAAPVARMVENYRYYNDANYERSRGGSF
SGHETVPDLRFKLKRNNSDFQPSYYQQTGPSYHANPYQHYQPRGSIGNQN
QEVGPNGFFGYGPRRYSNTSTISANTAAALGDVSPISSAVNSGGNPMVSG
ISSLQRRLSNCSEQNYTPEVNPSMSRRASNCSETGGVPQRRDSNCSESCP
CSRRVSDFAQTTDTSYRKTSVCSNGSCPGNNQNQERRFSNGSMQFERTFS
NASESSGFYRRPSNDFNIEREPIQTDQLVGGGGGGYQVWPRRYSNNFQQL
SSKLAAYDNAQYIGGRRISTDSGYDRRCSFGSEGFEGSPRSRTGSFLSNY
KHGGGDGYDGQPRSRTGSFLDGSPRSRSGSFAQRAAESLVRTPMGPDGSK
GFGQRARKFGQTISPVN*

FI03833.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 13:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13506-PA 861 GF13506-PA 1..861 1..867 3675 86.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 13:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20457-PA 875 GG20457-PA 1..875 1..867 4315 95 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 13:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19749-PA 885 GH19749-PA 14..885 12..867 2959 75 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG17386-PB 867 CG17386-PB 1..867 1..867 4523 100 Plus
CG17386-PA 867 CG17386-PA 1..867 1..867 4523 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 13:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20285-PA 902 GI20285-PA 5..902 7..866 3016 74.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 13:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10694-PA 865 GL10694-PA 1..865 1..867 3425 81.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 13:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14498-PA 865 GA14498-PA 1..865 1..867 3429 81.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 13:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21546-PA 867 GM21546-PA 1..867 1..867 4427 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 13:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11054-PA 867 GD11054-PA 1..867 1..867 4587 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 13:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22012-PA 882 GJ22012-PA 16..882 12..867 3035 76.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 13:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21479-PA 856 GK21479-PA 5..856 10..867 2939 74.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 13:55:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13588-PA 866 GE13588-PA 1..866 1..867 4352 96.2 Plus

FI03833.hyp Sequence

Translation from 698 to 3301

> FI03833.hyp
MSSPRDKAEQVYEVKAPHAGAEGHTFLVSPVDPTPILAPILTAVPVMKAP
DSPASMDKTKEMEELDDEQPSCSSQAVVPLSSSLPCKLLRMHARRSAQAL
LHQMESMDSQLGSSNGSTSEDTSPSAPPMSPTDHQLVDVGMGSSIGDSDE
SSEEGDELKPLAVDNHIIAEVDLTERQTTPPAVLSEANLEKFRKHQMDNI
YLHPNFTLDASPPPAVAPANSPVLEAKRTHRSFLTMKKEKEVEPPQEKEQ
EVPVHQEQDTEPQGPNEIDTLDPSLIPSEELAAEITDAVEFYFSNESILK
DAFLLKHVRRNKEGFVSLKLVSSFKRVRQLTREWKVVGDAVRRKSRKIEL
NDVGTKVRRIEPLPSFDETMPSRTIVACDLPLDKLTIEKVSDLFSPCGEI
ALIRILKPGMAIPVDVRQFMNKYPELQQKECALVEYLESSSARDARHLNG
PFQVYEMVAPKKKTGKKAAVIQIAAPVARMVENYRYYNDANYERSRGGSF
SGHETVPDLRFKLKRNNSDFQPSYYQQTGPSYHANPYQHYQPRGSIGNQN
QEVGPNGFFGYGPRRYSNTSTISANTAAALGDVSPISSAVNSGGNPMVSG
ISSLQRRLSNCSEQNYTPEVNPSMSRRASNCSETGGVPQRRDSNCSESCP
CSRRVSDFAQTTDTSYRKTSVCSNGSCPGNNQNQERRFSNGSMQFERTFS
NASESSGFYRRPSNDFNIEREPIQTDQLVGGGGGGYQVWPRRYSNNFQQL
SSKLAAYDNAQYIGGRRISTDSGYDRRCSFGSEGFEGSPRSRTGSFLSNY
KHGGGDGYDGQPRSRTGSFLDGSPRSRSGSFAQRAAESLVRTPMGPDGSK
GFGQRARKFGQTISPVN*

FI03833.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG17386-PB 867 CG17386-PB 1..867 1..867 4523 100 Plus
CG17386-PA 867 CG17386-PA 1..867 1..867 4523 100 Plus