Clone FI03837 Report

Search the DGRC for FI03837

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:38
Well:37
Vector:pOT2
Associated Gene/TranscriptCnx99A-RA
Protein status:FI03837.pep: gold
Sequenced Size:2076

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cnx99A 2008-12-18 5.12 accounting

Clone Sequence Records

FI03837.complete Sequence

2076 bp assembled on 2008-08-28

GenBank Submission: BT044173.1

> FI03837.complete
AAAATGTATAATTTACATTAATTTAATTACAAATAGTTCGTCGTGCCAGA
TCTCGATTCTTGTTATTCCGCAACAGACCGCAGTGGGGGAAAACTGTTGA
AAAGCACAGCGCGCACAAGTGAGTCCACCACCTGGTTTTCCGCGGATACT
AAATCCCAGCCAGGCAGCCAGCGAGCGAGCGAAAAGTGGGTGAAAATGGC
GTGGAAAATGGGAGGAAACCGGGCCGCAACGCTGGCGTTGCTCTTCGCCA
GCAGTTTGCTGCTGCTGAGTGCGGCCAATGCCGCCGATTTGGACACGGAG
TCGGACGACTTCGAGGATGGTTATGTGGAGGATGTGCAGGAGGAGCCCGC
CGTCATCGGTGGCGATGAGAAGCTGGCCTACGAGAGCCCGGTTATCGATG
CCAAGAAGTTCCACTTCGCGGATCACTTCGACGACGTGGAGGAGTCCAGG
AAGAGGTGGGTGCTGTCGCAGGCCAAGAAGGACGACATCGCCGAGGAGAT
CTCCAAGTACGACGGCATCTGGAACTGGGAGTCGCCGCAGCGCATCGTTT
GGGCTAACGACTTGGGTCTGGTGCTCAAGTCGAAGGCCAAACACGCGGCC
ATAGCCGCCCCCCTCCGCAAACCGTTCGAGTTCAAGTCGGACAAGCCGCT
GGTGGTGCAGTACGAGGTCACGTTGCAGGAGGGTCAGGAGTGCGGTGGCT
CGTATCTGAAGCTTTTGTCCGCCGGAAAAGACACGGAGCAACTAAAAGCG
TTCAATGACAAGACACCCTATACCATCATGTTTGGACCGGACAAGTGCGG
CAACGATGTGAAAATGCACTTCATATTCCGGCACGTCAATCCAATTAATG
GCACCATCACCGAGAAGCACTGCAACAAGCCAAAGAACCGTTTGGAAGAG
CCATTCAAGGACAAGCTACCCCATCTCTACCAGCTGGTGGTCCGTCCCGA
TAACAGCTTTGAGATTCGCGTTGACCACAAGATCATCAATGAGGGTTCCC
TGCTAACCGATTTCAAGCCACCAGTCAACCCGCCGGCAGAGATCGACGAC
CCCAATGACCACAAGCCCGAATCGTGGGATGAGCGAGAGAAGATCCCAGA
TCCCACTGCCCACAAGCCCGAGGATTGGGATGAGGATGCTCCACCCCAGT
TGCCCGATACCGATGCCGTCATGCCCAATGGCTGGCTCGAAGATGAGCCC
GACATGATTTTCGATCCAACTGCCACCAAACCCGAGGATTGGGATGCCGA
AATCGATGGCGAGTGGGAGGCTCCATTGGTGGACAATCCAGTGTGCGAGA
AGGCTCCCGGCTGTGGCAAGTGGAAGGCTCCGCTCATCCCCAATCCCAAC
TACAAGGGCAAGTGGCGTGCACCAATGATCGAGAACCCCAACTACCAGGG
CAAGTGGGCACCCAGGAAGATTCCCAATCCAGACTTCTTTGAGGATCTGA
AGCCCTTCCAAATGACGCCCATCAGCGCTGTGGGTCTGGAACTGTGGTCC
ATGTCCAGCGATATTCTCTTCGACAACCTAATCATCACGGACGACGTGGA
GGTGGCCCGTGACTTTGCCGCCAACAGCTTCGACATCAAGCGTCGCTACA
TCGATCGTGAATCGGACTCATTCGTGAATAAGGTAGTCGAGCTAGCCAAG
GCCAATCCCTCGATCTGGGGCATTGGCTTGGTGGCCATTGTGGCGCTGGT
TGCCCTCACCATCTACTGTAGATTTGGTACCGCTAAGAGTCAGGACTCGG
CTGCCAAAAAGGCTGCTGCCGAGGCCAAGAAGTCCGACGATCCTCAGCCC
GACGATGAGCCCGAGGCCGAGGAGGAGAGCGACGAAAGGGCCGCTGGCGA
TACCAGCAAGGAGAGCACACCGCTGTCCGCTAGTCCCAAGAAGAACCAAA
AGTCTGATTTAGATGATAACGAAGAGGAGTCCAAGGCGGCGGAGAGCCGA
GAGCCCGCACAGACTGAGGAATCTAACACAAAAACACGCAAGCGTCAAGC
GCGCAAGGAGTAAGCGGGCATCCCCACATGCCGAATCCGAAAACAAACAC
TGCAACTCTAAAAAAAAAAAAAAAAA

FI03837.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
Cnx99A.d 2857 Cnx99A.d 242..2315 1..2074 10355 99.9 Plus
Cnx99A-RD 2516 Cnx99A-RD 242..2315 1..2074 10355 99.9 Plus
Cnx99A-RC 2776 Cnx99A-RC 46..1659 1..1614 8070 100 Plus
Cnx99A-RC 2776 Cnx99A-RC 1785..2245 1614..2074 2290 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16413300..16414800 1827..324 5035 89.3 Minus
chrX 22417052 chrX 12068637..12069572 1138..191 2920 87.4 Minus
chr3R 27901430 chr3R 25139688..25140276 1473..885 2840 98.8 Minus
chrX 22417052 chrX 12068075..12068615 1754..1199 1770 88.3 Minus
chr3R 27901430 chr3R 25141020..25141364 679..335 1665 98.8 Minus
chr3R 27901430 chr3R 25141978..25142317 340..1 1640 98.8 Minus
chr3R 27901430 chr3R 25138703..25138930 1969..1742 1125 99.6 Minus
chr3R 27901430 chr3R 25139484..25139625 1615..1474 710 100 Minus
chr3R 27901430 chr3R 25140600..25140735 885..750 680 100 Minus
chr3R 27901430 chr3R 25139001..25139135 1744..1610 660 99.3 Minus
chrX 22417052 chrX 20740438..20740624 264..450 485 84 Plus
chr3R 27901430 chr3R 25138548..25138640 2059..1967 465 100 Minus
chrX 22417052 chrX 16413030..16413141 1929..1818 440 92.9 Minus
chr3R 27901430 chr3R 25140834..25140907 750..677 355 98.6 Minus
chrX 22417052 chrX 20740262..20740371 37..145 260 84.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
Cnx99A-RD 1818 CG11958-PD 1..1818 196..2013 9090 100 Plus
Cnx99A-RB 1818 CG11958-PB 1..1818 196..2013 9090 100 Plus
Cnx99A-RA 1818 CG11958-PA 1..1818 196..2013 9090 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:40 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
Cnx99A-RD 2092 CG11958-RD 30..2088 1..2059 10295 100 Plus
Cnx99A-RB 2623 CG11958-RB 30..2088 1..2059 10295 100 Plus
Cnx99A-RA 2615 CG11958-RA 58..2080 37..2059 10115 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
Cnx99A-PD 605 CG11958-PD 1..605 196..2010 2870 100 Plus
Cnx99A-PB 605 CG11958-PB 1..605 196..2010 2870 100 Plus
Cnx99A-PA 605 CG11958-PA 1..605 196..2010 2870 100 Plus
Cnx99A-PE 604 CG11958-PE 1..604 196..2010 2682 93.6 Plus
Cnx14D-PA 639 CG9906-PA 29..494 325..1728 2221 86.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16523638..16525138 1827..324 5035 89.3 Minus
3R 32079331 3R 29316923..29317511 1473..885 2945 100 Minus
X 23542271 X 12177677..12178612 1138..191 2905 87.3 Minus
X 23542271 X 12177115..12177655 1754..1199 1785 88.5 Minus
3R 32079331 3R 29318273..29318617 679..335 1725 100 Minus
3R 32079331 3R 29319230..29319569 340..1 1700 100 Minus
3R 32079331 3R 29315944..29316171 1969..1742 1140 100 Minus
3R 32079331 3R 29316719..29316860 1615..1474 710 100 Minus
3R 32079331 3R 29317835..29317970 885..750 680 100 Minus
3R 32079331 3R 29316236..29316370 1744..1610 660 99.3 Minus
3R 32079331 3R 29315774..29315881 2074..1967 525 99.1 Minus
X 23542271 X 20875117..20875303 264..450 500 84.5 Plus
X 23542271 X 16523368..16523479 1929..1818 440 92.9 Minus
3R 32079331 3R 29318069..29318142 750..677 370 100 Minus
X 23542271 X 20874941..20875050 37..145 260 84.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16531838..16533236 1728..324 4915 90.1 Minus
3R 31820162 3R 29057754..29058342 1473..885 2945 100 Minus
X 23527363 X 12185775..12186550 1138..363 2695 89.8 Minus
3R 31820162 3R 29059104..29059448 679..335 1725 100 Minus
3R 31820162 3R 29060061..29060400 340..1 1700 100 Minus
X 23527363 X 12185213..12185633 1754..1334 1610 92.1 Minus
3R 31820162 3R 29056775..29057002 1969..1742 1140 100 Minus
3R 31820162 3R 29057550..29057691 1615..1474 710 100 Minus
3R 31820162 3R 29058666..29058801 885..750 680 100 Minus
3R 31820162 3R 29057067..29057201 1744..1610 660 99.2 Minus
3R 31820162 3R 29056605..29056712 2074..1967 525 99 Minus
X 23527363 X 20860209..20860395 264..450 500 84.4 Plus
X 23527363 X 16531466..16531577 1929..1818 440 92.8 Minus
X 23527363 X 12185649..12185753 1303..1199 375 90.4 Minus
X 23527363 X 12186556..12186710 345..191 370 82.5 Minus
3R 31820162 3R 29058900..29058973 750..677 370 100 Minus
X 23527363 X 20860033..20860142 37..145 270 84.5 Plus
X 23527363 X 16531736..16531801 1827..1762 225 89.3 Minus
X 23527363 X 20860147..20860199 168..220 175 88.6 Plus
X 23527363 X 12185179..12185218 1800..1761 170 95 Minus
X 23527363 X 16533305..16533345 210..170 160 92.6 Minus
X 23527363 X 12185003..12185073 1979..1909 160 81.6 Minus
X 23527363 X 16533243..16533293 305..255 150 86.2 Minus
X 23527363 X 16531390..16531446 2023..1967 150 84.2 Minus
Blast to na_te.dros performed on 2014-11-27 10:56:45 has no hits.

FI03837.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed on 2014-11-27 11:53:07 has no hits.
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:46:35 Download gff for FI03837.complete
Subject Subject Range Query Range Percent Splice Strand
Cnx99A-RB 1..1818 196..2013 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:11:37 Download gff for FI03837.complete
Subject Subject Range Query Range Percent Splice Strand
Cnx99A-RB 1..1818 196..2013 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:24:49 Download gff for FI03837.complete
Subject Subject Range Query Range Percent Splice Strand
Cnx99A-RA 1..1818 196..2013 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:52 Download gff for FI03837.complete
Subject Subject Range Query Range Percent Splice Strand
Cnx99A-RB 1..1818 196..2013 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:53:07 Download gff for FI03837.complete
Subject Subject Range Query Range Percent Splice Strand
Cnx99A-RA 1..1818 196..2013 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:08:56 Download gff for FI03837.complete
Subject Subject Range Query Range Percent Splice Strand
Cnx99A-RB 46..2104 1..2059 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:11:37 Download gff for FI03837.complete
Subject Subject Range Query Range Percent Splice Strand
Cnx99A-RB 46..2104 1..2059 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:24:49 Download gff for FI03837.complete
Subject Subject Range Query Range Percent Splice Strand
Cnx99A-RB 30..2088 1..2059 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:05:51 Download gff for FI03837.complete
Subject Subject Range Query Range Percent Splice Strand
Cnx99A-RD 46..2104 1..2059 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:53:07 Download gff for FI03837.complete
Subject Subject Range Query Range Percent Splice Strand
Cnx99A-RB 30..2088 1..2059 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed on 2014-11-27 11:53:07 has no hits.
Sim4 to na_arms.dmel.RELEASE5 performed on 2013-08-04 16:24:49 has no hits.
Sim4 to na_arms.dmel.RELEASE6 performed on 2011-12-09 18:41:54 has no hits.

FI03837.pep Sequence

Translation from 195 to 2012

> FI03837.pep
MAWKMGGNRAATLALLFASSLLLLSAANAADLDTESDDFEDGYVEDVQEE
PAVIGGDEKLAYESPVIDAKKFHFADHFDDVEESRKRWVLSQAKKDDIAE
EISKYDGIWNWESPQRIVWANDLGLVLKSKAKHAAIAAPLRKPFEFKSDK
PLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDK
CGNDVKMHFIFRHVNPINGTITEKHCNKPKNRLEEPFKDKLPHLYQLVVR
PDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKI
PDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWD
AEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNY
QGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDD
VEVARDFAANSFDIKRRYIDRESDSFVNKVVELAKANPSIWGIGLVAIVA
LVALTIYCRFGTAKSQDSAAKKAAAEAKKSDDPQPDDEPEAEEESDERAA
GDTSKESTPLSASPKKNQKSDLDDNEEESKAAESREPAQTEESNTKTRKR
QARKE*

FI03837.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 21:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22893-PA 652 GF22893-PA 1..652 1..605 2481 79.1 Plus
Dana\GF18838-PA 404 GF18838-PA 62..338 122..454 514 35.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 21:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12019-PA 651 GG12019-PA 1..651 1..605 2762 88.6 Plus
Dere\GG17350-PA 406 GG17350-PA 69..344 131..459 521 36.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 21:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14000-PA 598 GH14000-PA 1..598 1..605 2251 75.6 Plus
Dgri\GH19579-PA 403 GH19579-PA 61..337 122..454 498 35.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Cnx99A-PD 605 CG11958-PD 1..605 1..605 3232 100 Plus
Cnx99A-PB 605 CG11958-PB 1..605 1..605 3232 100 Plus
Cnx99A-PA 605 CG11958-PA 1..605 1..605 3232 100 Plus
Cnx99A-PE 604 CG11958-PE 1..604 1..605 3035 93.9 Plus
Cnx14D-PA 639 CG9906-PA 1..639 1..605 2443 72.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 21:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22345-PA 614 GI22345-PA 9..614 7..605 2407 77 Plus
Dmoj\GI23963-PA 397 GI23963-PA 77..342 146..465 506 35.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 21:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13597-PA 649 GL13597-PA 1..649 1..605 2315 73.7 Plus
Dper\GL21957-PA 405 GL21957-PA 63..345 122..460 520 37 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 21:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26840-PA 607 GA26840-PA 1..607 1..605 2372 78.8 Plus
Dpse\GA26840-PB 649 GA26840-PB 1..649 1..605 2315 73.7 Plus
Dpse\GA27323-PB 382 GA27323-PB 61..322 145..460 509 36.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 21:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13395-PA 645 GM13395-PA 26..523 41..538 2154 82.5 Plus
Dsec\GM13150-PA 557 GM13150-PA 1..551 1..575 2056 74.6 Plus
Dsec\GM12245-PA 215 GM12245-PA 1..145 1..145 628 95.2 Plus
Dsec\GM26236-PA 406 GM26236-PA 69..344 131..459 514 36.6 Plus
Dsec\GM23053-PA 180 GM23053-PA 118..180 23..85 244 77.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 21:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17820-PA 648 GD17820-PA 1..648 1..605 2855 91.2 Plus
Dsim\GD15935-PA 551 GD15935-PA 1..538 1..576 1949 71.2 Plus
Dsim\GD15746-PA 355 GD15746-PA 1..199 326..538 748 72.3 Plus
Dsim\GD20777-PA 406 GD20777-PA 69..344 131..459 514 36.6 Plus
Dsim\GD24694-PA 67 GD24694-PA 24..67 42..85 153 70.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 21:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14222-PA 662 GJ14222-PA 46..662 42..605 2203 72.9 Plus
Dvir\GJ22515-PA 403 GJ22515-PA 61..348 122..465 505 35.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 21:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11031-PA 646 GK11031-PA 1..646 1..605 2299 71.6 Plus
Dwil\GK17146-PA 583 GK17146-PA 17..583 44..605 1862 61.4 Plus
Dwil\GK13913-PA 403 GK13913-PA 61..343 122..460 518 35.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 21:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10455-PA 651 GE10455-PA 1..651 1..605 2788 89.7 Plus
Dyak\GE24756-PA 406 GE24756-PA 69..344 131..459 517 36.6 Plus

FI03837.hyp Sequence

Translation from 195 to 2012

> FI03837.hyp
MAWKMGGNRAATLALLFASSLLLLSAANAADLDTESDDFEDGYVEDVQEE
PAVIGGDEKLAYESPVIDAKKFHFADHFDDVEESRKRWVLSQAKKDDIAE
EISKYDGIWNWESPQRIVWANDLGLVLKSKAKHAAIAAPLRKPFEFKSDK
PLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDK
CGNDVKMHFIFRHVNPINGTITEKHCNKPKNRLEEPFKDKLPHLYQLVVR
PDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKI
PDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWD
AEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNY
QGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDD
VEVARDFAANSFDIKRRYIDRESDSFVNKVVELAKANPSIWGIGLVAIVA
LVALTIYCRFGTAKSQDSAAKKAAAEAKKSDDPQPDDEPEAEEESDERAA
GDTSKESTPLSASPKKNQKSDLDDNEEESKAAESREPAQTEESNTKTRKR
QARKE*

FI03837.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Cnx99A-PD 605 CG11958-PD 1..605 1..605 3232 100 Plus
Cnx99A-PB 605 CG11958-PB 1..605 1..605 3232 100 Plus
Cnx99A-PA 605 CG11958-PA 1..605 1..605 3232 100 Plus
Cnx99A-PE 604 CG11958-PE 1..604 1..605 3035 93.9 Plus
Cnx14D-PA 639 CG9906-PA 1..639 1..605 2443 72.8 Plus