Clone FI03887 Report

Search the DGRC for FI03887

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:38
Well:87
Vector:pOT2
Associated Gene/TranscriptCG7441-RA
Protein status:FI03887.pep: gold
Sequenced Size:2224

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7441 2008-12-18 5.12 accounting

Clone Sequence Records

FI03887.complete Sequence

2224 bp assembled on 2008-08-15

GenBank Submission: BT044176.1

> FI03887.complete
CAACGCTCGCGAACGCTCAGTGTCAAAATTTCGGCCGTTTCGAACAAATA
ATTTATTTTTGGGCTTTGTTCACACATTTAGCACCGCATTATTCCCAATA
TTTTTTACTCAAAAGTTTTGGGGTACAAAATTCATAGCTCATTGCAATGT
TCCGATTTGGCAAGCTCCATCGCAGTCTGTCTAAGGTGGCCAAAAAGGGA
CAGACAGCTGTGTATTCCCAGCGCCGTTGCATTCAGGCGAGGAGTTTCTT
GCCGGGATTGGCTAGTAGGACGGCTGGAACGCCCTCTGCGACGGCCCAGG
TAACCGGTGGAAACAAGCAGCACGTACACCCCCATGGTAATTCCGTTAAC
AGTGGCCACGAAGAACATAACACCCGCTGGCCGAGGAAAGTCTTTAGTGG
CATCCAGCCGACGGGTTCCCTGCATCTGGGTAATTATCTCGGCGCCGTGC
GCAAATGGGTGCAGCTGCAGAATGCTCGTGACGATGTCACCGTGTGTATT
GTGGATTTGCACTCTATTACCATGCCCCACAATCCGCCGCTTCTGCGAGA
GAACATCTTCACCATGGCCGCCACGTTGTTGGCATGTGGCATCGATCCCA
CCAAGAGCACCCTCTTTGTCCAGTCCGCCGTTGCCGAGCACGCCGAGTTC
AATTGGATCCTTAGCTCCTTGACCACCATGCCGCGATTGGCTCAACTGCC
GCAGTTCCGAGAGAAGTCCCGTCTTCTAAAGGATGTCCCTCTGGGATTGT
ACGTTTACCCGGTTCTCCAAGCAGCCGACATTATGCTTTACAAGTCCACT
CATGTTCCTGTGGGCGCTGACCAGATTCAGCACATTCAGCTGGCCCAGCA
CTTGGCCAGAATTTATAACGGTCGCTATGGCGAGACTTTCCCTGTTTGCA
CCGCCATCATTGAGGATGGTGATGCCTCCCGTGTGCTGTCCCTGCGAGAT
CCCTCCAAAAAGATGTCTAAATCGGAAGCGAATCCCAAGGCCACCATCAA
CTTGTGTGACTCGCCCGACTTGATTACGCAGAAGATAAAGAAAGCCGTCA
CAGACTTTACATCGGACATTACTTATAATCCTGGCAAGCGTGCTGGCGTC
AGCAATCTGGTCAACATCCATGCCCAGGTCACGGGACAGAGCATTAAGAC
AGTGGTGAACGAGGCCGCCACTTTGGACACGGCAAAGTATAAGGACCGTG
TGGCGGAGGCTGTGGTCGAGCACTTGCGTCCGATCCGAGAACAGATACAC
CATCACATGACTAAGCGCAACGAGATGATCTACTTGCTGGAAGTGGGTGC
AGAAAAGGCACGTCAGCAGGCACGCCAAACGTTGAACGATGTTAAACAGC
GCCTAGGACTAGGAACCAGTGCCAACATTCCGGCTGCGGTGCATGTGGCT
CCACTTCTGCCCGCACCCGATATTTCCAAAACCTCAGCAAGCAGGCGAAT
GTCCAAGGACTTCGACGGGAATGTCCACGAGCGTCACGAACGGATGTACG
GATTCGGAGATCAGCCAAGCGGAGGAGCTGGTCAGTCAGCCACCGGCGAG
GTGGCGGATATGCCTCAGGCCGTTGTACCGCGGGTGATCCGTCGGGCGCC
CATCGTTCCCACTCAGTCTATGCGCGTAGAGAAACAACTAGGTAGCACTC
GAACTCGGCACGTATTCCAGATGGACACCTGCAATGCTCCGCATATAGGG
TTCAAACCGCCGCCAGGATTTTCGGCCAGCATGGTCACCGGTGCTCTAGC
CAAGAACAAGCGCGCTACAGTTAAACCCGTTACTGGCAACCTGGGCTTCG
GCCAGCAATCGCAGGGTGGCTCTTACAAGCACAGCCAGAACGTGAATCCT
AGTGCGGTATCCACCATTGCACGTGAAGTAAACGCTGCTAAGAAGCAGGA
GTTTACCTGCAACCCCGCTTTGTACGGCTCTGCCTTAGAATCGCTTTCCA
ATTCAAGTCGCTCGAGCGAAAAGACTAACTCTACGGCAGGAGACAGTGAG
TTCATAATTGTCGCGAGCGAGGAGGAAGAGCAGGCTGCTTCCTCTGAGGA
GCAACGCGAAGAAGCTGAAGAGGAGGAGTCCGGGGAACGTGAAAGGGAGA
AAGGCGAGCGCAACGCCACTGAAGCTACCAAAGTCGAGATTTAACTCTCG
GAAACATTGCAATTGTTATAAGTGTAGTACAAGTATACTTAGGTAACATT
ACTGTTAAAAAAAAAAAAAAAAAA

FI03887.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7441-RA 2515 CG7441-RA 40..2248 1..2209 11045 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17840387..17841799 794..2206 7065 100 Plus
chr3L 24539361 chr3L 17839771..17840200 366..795 2150 100 Plus
chr3L 24539361 chr3L 17839344..17839708 1..365 1825 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG7441-RB 1998 CG7441-PB 1..1998 147..2144 9990 100 Plus
CG7441-RA 1998 CG7441-PA 1..1998 147..2144 9990 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:48 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG7441-RB 2213 CG7441-RB 8..2213 1..2206 11030 100 Plus
CG7441-RA 2477 CG7441-RA 8..2213 1..2206 11030 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG7441-PB 665 CG7441-PB 1..665 147..2141 2946 100 Plus
CG7441-PA 665 CG7441-PA 1..665 147..2141 2946 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17850777..17852192 794..2209 7080 100 Plus
3L 28110227 3L 17850161..17850590 366..795 2150 100 Plus
3L 28110227 3L 17849734..17850098 1..365 1825 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17843877..17845292 794..2209 7080 100 Plus
3L 28103327 3L 17843261..17843690 366..795 2150 100 Plus
3L 28103327 3L 17842834..17843198 1..365 1825 100 Plus
Blast to na_te.dros performed on 2014-11-26 23:14:20 has no hits.

FI03887.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:26:16 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17840387..17841799 794..2206 100   Plus
chr3L 17839771..17840198 366..793 100 -> Plus
chr3L 17839344..17839708 1..365 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:46:46 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 1..1998 147..2144 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:21 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 1..1998 147..2144 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:07 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 1..1998 147..2144 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:31 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 1..1998 147..2144 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:26:16 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 1..1998 147..2144 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:31 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 40..2245 1..2206 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:21 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 40..2245 1..2206 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:07 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 8..2213 1..2206 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-15 15:25:56 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 40..2245 1..2206 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:26:16 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
CG7441-RA 8..2213 1..2206 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:26:16 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17850777..17852189 794..2206 100   Plus
3L 17850161..17850588 366..793 100 -> Plus
3L 17849734..17850098 1..365 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:07 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17843877..17845289 794..2206 100   Plus
arm_3L 17843261..17843688 366..793 100 -> Plus
arm_3L 17842834..17843198 1..365 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:38 Download gff for FI03887.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17843877..17845289 794..2206 100   Plus
3L 17843261..17843688 366..793 100 -> Plus
3L 17842834..17843198 1..365 100 -> Plus

FI03887.pep Sequence

Translation from 146 to 2143

> FI03887.pep
MFRFGKLHRSLSKVAKKGQTAVYSQRRCIQARSFLPGLASRTAGTPSATA
QVTGGNKQHVHPHGNSVNSGHEEHNTRWPRKVFSGIQPTGSLHLGNYLGA
VRKWVQLQNARDDVTVCIVDLHSITMPHNPPLLRENIFTMAATLLACGID
PTKSTLFVQSAVAEHAEFNWILSSLTTMPRLAQLPQFREKSRLLKDVPLG
LYVYPVLQAADIMLYKSTHVPVGADQIQHIQLAQHLARIYNGRYGETFPV
CTAIIEDGDASRVLSLRDPSKKMSKSEANPKATINLCDSPDLITQKIKKA
VTDFTSDITYNPGKRAGVSNLVNIHAQVTGQSIKTVVNEAATLDTAKYKD
RVAEAVVEHLRPIREQIHHHMTKRNEMIYLLEVGAEKARQQARQTLNDVK
QRLGLGTSANIPAAVHVAPLLPAPDISKTSASRRMSKDFDGNVHERHERM
YGFGDQPSGGAGQSATGEVADMPQAVVPRVIRRAPIVPTQSMRVEKQLGS
TRTRHVFQMDTCNAPHIGFKPPPGFSASMVTGALAKNKRATVKPVTGNLG
FGQQSQGGSYKHSQNVNPSAVSTIAREVNAAKKQEFTCNPALYGSALESL
SNSSRSSEKTNSTAGDSEFIIVASEEEEQAASSEEQREEAEEEESGERER
EKGERNATEATKVEI*

FI03887.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24575-PA 702 GF24575-PA 1..702 1..665 2384 66.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13636-PA 662 GG13636-PA 1..662 1..665 3159 91.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17095-PA 683 GH17095-PA 1..609 1..606 1634 54 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG7441-PB 665 CG7441-PB 1..665 1..665 3411 100 Plus
CG7441-PA 665 CG7441-PA 1..665 1..665 3411 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11697-PA 627 GI11697-PA 1..509 92..601 1519 58.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22853-PA 679 GL22853-PA 14..677 27..665 1797 55.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20355-PA 679 GA20355-PA 14..677 27..665 1795 55.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25723-PA 664 GM25723-PA 1..664 1..665 3228 94.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14730-PA 664 GD14730-PA 1..664 1..665 3238 95 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11372-PA 691 GJ11372-PA 37..575 65..596 1720 60.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10371-PA 707 GK10371-PA 95..623 72..597 1810 65.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19932-PA 662 GE19932-PA 1..662 1..665 3112 89.8 Plus

FI03887.hyp Sequence

Translation from 146 to 2143

> FI03887.hyp
MFRFGKLHRSLSKVAKKGQTAVYSQRRCIQARSFLPGLASRTAGTPSATA
QVTGGNKQHVHPHGNSVNSGHEEHNTRWPRKVFSGIQPTGSLHLGNYLGA
VRKWVQLQNARDDVTVCIVDLHSITMPHNPPLLRENIFTMAATLLACGID
PTKSTLFVQSAVAEHAEFNWILSSLTTMPRLAQLPQFREKSRLLKDVPLG
LYVYPVLQAADIMLYKSTHVPVGADQIQHIQLAQHLARIYNGRYGETFPV
CTAIIEDGDASRVLSLRDPSKKMSKSEANPKATINLCDSPDLITQKIKKA
VTDFTSDITYNPGKRAGVSNLVNIHAQVTGQSIKTVVNEAATLDTAKYKD
RVAEAVVEHLRPIREQIHHHMTKRNEMIYLLEVGAEKARQQARQTLNDVK
QRLGLGTSANIPAAVHVAPLLPAPDISKTSASRRMSKDFDGNVHERHERM
YGFGDQPSGGAGQSATGEVADMPQAVVPRVIRRAPIVPTQSMRVEKQLGS
TRTRHVFQMDTCNAPHIGFKPPPGFSASMVTGALAKNKRATVKPVTGNLG
FGQQSQGGSYKHSQNVNPSAVSTIAREVNAAKKQEFTCNPALYGSALESL
SNSSRSSEKTNSTAGDSEFIIVASEEEEQAASSEEQREEAEEEESGERER
EKGERNATEATKVEI*

FI03887.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG7441-PB 665 CG7441-PB 1..665 1..665 3411 100 Plus
CG7441-PA 665 CG7441-PA 1..665 1..665 3411 100 Plus