Clone FI03911 Report

Search the DGRC for FI03911

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:39
Well:11
Vector:pOT2
Associated Gene/Transcriptupd3-RB
Protein status:FI03911.pep: gold
Sequenced Size:2242

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
upd3 2008-08-15 Release 5.9 accounting
upd3 2008-12-18 5.12 accounting

Clone Sequence Records

FI03911.complete Sequence

2242 bp assembled on 2008-07-31

GenBank Submission: BT044177.1

> FI03911.complete
CAGCGCTGTTGACTTCGACTTCGATCGAATCGGAATCAAATCATAGCAGA
CAGTCGAAGGCAGCGCGTCGACACTTAACGCGATAGTTCGTCCAGCCGCG
ATATAAAGATACAAAGATACGCAGCCAAATTCAACAAATTCAACAAATTC
GACAAAGTCGCCTGATTCGCCTGATTCGCCAAATTCGCCAAATCGCGATC
GCTTTTATTATTGGTTAGTTTTTTTTTTCGTTTTTTTCCCCGTTGCATTC
TGGAAGCTTCTTTCCGGCAAATACACACAAAGAAAAGACTAACAGCGTTA
CAAAAGCAAAGTGCGTGTCAATCAAGTACGAATTTTTGTGCGGAATTCCC
AGCCAACGATTTTTATGTAAATGACGACAGCTGACCGCCCGCTCGACGTC
AGCAGGAGCAGCGGAAGCGGTAGCCGGAGCGGTAACAAAACGGCCAGAAC
CAGGAATCCAGTGGAACCGCAGCCGCAACCGCCGTTCGTGGATCGACGAC
GACGCCTGAACAGGAACTGGTCACTGATCTTACTCGCCTTGGCCATGTCC
CAGTTTGCCCTCTCCGGCGGCGGTTGTGGCGTCTCAGCGGCGCCCAGTCA
CCTGGCCACCCCGCCCACTGACAGCCCCTCCAGTCCCATCAATCCCACCA
ATCCCCTGAAGCACCTACAGAAGCGTTCCAGAGCGGCCAACTTCCGGCTG
ACCTTCCAGCAGAAATTGAATGCCAGCAGTACGCATCTGGACTGGGAGAA
CACCTGCAATCTGAAGCCCACGGGTCTGAACGAAACGCATAGCAAGGCGA
AACGCTGCAAGAAACGCCAAAGGATCCTGCAGAATCTACAGAACCAAACG
GGCCGCGAGCTGCGGGGCATCCAGGCCGAGGACAAGGCCAGGATCACCAC
CAATGCGGACAAGCTGGCCACAGTGAGCACCAAGACTCTGGACATTGTCG
AGAAGAACAAGTGGCGATTCTATAAGGGAAACTACAGATTCCTGCCCCGT
CTGAATCTCACTAGCAAACAGTTGAACCTTCGCCACGCCCATCGCGACCT
GCAGATTTACGTGGGCGCCTTCACGTACATGCGCAACATCAAGTTGCATT
GGGACCTGGCCAACTTGCAGGCGAAGAGCGTGCTCTCCGACGAGCTGGGA
AGGATGCGGAAGTCCGCCCGCGAGGTGCTCTGCAGCGTGGAGGAGGCCAT
CAACCTGACCAACCTGCTGTACACACCCAACAGGCAGCGGGCGCCACAGC
CGAGGGGCCAGAAGAAGCGGCGCCAGGCCCAACCGGTGGTCACCTACAAG
ATACTGCCGCGCAAGCTGATGGAGAAGCGTCTGCAGCAGTTCAACTCGAC
GTTGGTGCCACTCGTGGAGCTGCACCAGCAGGCGACCTTGGCCGCACGCG
GGGAGGATGTACCACCACCGCCCGACGACCTGATGGTCCTGGAGCAGCAC
GCCCTCTTCACCAAACTGAAGTTTGTGCAGTATCTCAAGAGTATCCGCAA
GATACTCGCGAACCAGCGTAAGAGTCTGTGCAAGGCGACCACCCACGTGC
CAAAGGCGATCCAGAAGAAACTCTAGACGAGAGCAGAGAGCAGAGAGTAG
AAAGTAGAAAGTAGCTATAGCCAAGAGCTCAGAACCGGCGAAACCTCCAT
TCCACACAACGAGGCTCATTCCATGAAGACATCCTTAATTTATTAAACAT
CCAATATTTATTACTCACGCCACGCCACACCAGTCACGACGAATCACGAG
GAATCCCCGACAATCACAAGGCTATGAAAAACCGAATAAGTAATGTGAAC
AATCCACCACAGACGTGAATTTGAGATACCCAGTTTTCTCGATATTCTAA
CACGATAGTAATGTTTTCTCCGACTAAATTTATTATTATTATTATTTTTT
TTTTTTTTGATAGCTTTAAGTCCCATTGTATTATTTATTATTGCAACTCG
CCAACAATCTGCCGCACATTCCGCTAGATACTAAGTATACTAGATATACT
TTGCCTTGTATTACGATGCTGTGATAGTAGATGATTAAAGTAAACACAAC
GCTCCGCGACGGCCACAAGCTATATATCTCCCCCGACTATATTTACACAC
TGATATATGTATGTACGATTTACACCTCTATGTAACTTAGCTTTGATTAG
GAATTAACATTTTAGACATCAAATACAAACACAAATATACAAATATACAA
ATACAAACCATTGAAAGTACAAAAAAAAAAAAAAAAAAAAAA

FI03911.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
upd3-RB 2421 upd3-RB 198..2421 1..2223 11005 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18172520..18173721 1019..2220 5980 99.8 Plus
chrX 22417052 chrX 18168558..18169008 373..823 2255 100 Plus
chrX 22417052 chrX 18166358..18166730 1..373 1865 100 Plus
chrX 22417052 chrX 18169110..18169312 823..1025 1000 99.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
upd3-RB 1206 CG33542-PB 1..1206 371..1576 5985 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:49 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
upd3-RB 2221 CG33542-RB 1..2221 1..2220 10980 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
upd3-PB 401 CG33542-PB 1..401 371..1573 1949 100 Plus
os-PC 413 CG5993-PC 24..246 539..1288 187 27.6 Plus
os-PB 413 CG5993-PB 24..246 539..1288 187 27.6 Plus
os-PA 413 CG5993-PA 24..246 539..1288 187 27.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18283394..18284599 1019..2223 5920 99.6 Plus
X 23542271 X 18279433..18279883 373..823 2240 99.8 Plus
X 23542271 X 18277233..18277605 1..373 1865 100 Plus
X 23542271 X 18279985..18280187 823..1025 1000 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18291492..18292697 1019..2223 5930 99.5 Plus
X 23527363 X 18287531..18287981 373..823 2240 99.7 Plus
X 23527363 X 18285331..18285703 1..373 1865 100 Plus
X 23527363 X 18288083..18288285 823..1025 1000 99.5 Plus
Blast to na_te.dros performed 2014-11-27 14:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
BS 5142 BS BS 5142bp 5095..5142 1939..1892 114 70.8 Minus

FI03911.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:06:34 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18172523..18173721 1022..2220 99   Plus
chrX 18169111..18169308 824..1021 100 -> Plus
chrX 18168559..18169008 374..823 100 -> Plus
chrX 18166358..18166730 1..373 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:46:48 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 1..1206 371..1576 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:28 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 1..1206 371..1576 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:47:15 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 1..1206 371..1576 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:31 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 1..1206 371..1576 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:06:34 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 1..1206 371..1576 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:50:07 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 1..2221 1..2220 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:28 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 1..2221 1..2220 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:15 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 1..2221 1..2220 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-31 13:48:53 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 1..2221 1..2220 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:06:34 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
upd3-RB 1..2221 1..2220 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:06:34 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
X 18283397..18284596 1022..2220 99   Plus
X 18279986..18280183 824..1021 100 -> Plus
X 18279434..18279883 374..823 99 -> Plus
X 18277233..18277605 1..373 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:15 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18177430..18178629 1022..2220 99   Plus
arm_X 18174019..18174216 824..1021 100 -> Plus
arm_X 18173467..18173916 374..823 99 -> Plus
arm_X 18171266..18171638 1..373 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:30 Download gff for FI03911.complete
Subject Subject Range Query Range Percent Splice Strand
X 18291495..18292694 1022..2220 99   Plus
X 18288084..18288281 824..1021 100 -> Plus
X 18287532..18287981 374..823 99 -> Plus
X 18285331..18285703 1..373 100 -> Plus

FI03911.pep Sequence

Translation from 370 to 1575

> FI03911.pep
MTTADRPLDVSRSSGSGSRSGNKTARTRNPVEPQPQPPFVDRRRRLNRNW
SLILLALAMSQFALSGGGCGVSAAPSHLATPPTDSPSSPINPTNPLKHLQ
KRSRAANFRLTFQQKLNASSTHLDWENTCNLKPTGLNETHSKAKRCKKRQ
RILQNLQNQTGRELRGIQAEDKARITTNADKLATVSTKTLDIVEKNKWRF
YKGNYRFLPRLNLTSKQLNLRHAHRDLQIYVGAFTYMRNIKLHWDLANLQ
AKSVLSDELGRMRKSAREVLCSVEEAINLTNLLYTPNRQRAPQPRGQKKR
RQAQPVVTYKILPRKLMEKRLQQFNSTLVPLVELHQQATLAARGEDVPPP
PDDLMVLEQHALFTKLKFVQYLKSIRKILANQRKSLCKATTHVPKAIQKK
L*

FI03911.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 18:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22431-PA 404 GF22431-PA 111..389 92..384 628 49.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 18:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19156-PA 480 GG19156-PA 77..480 2..387 1493 79.3 Plus
Dere\GG18131-PA 428 GG18131-PA 24..246 57..307 183 27.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 18:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17723-PA 417 GH17723-PA 102..396 82..387 488 40.5 Plus
Dgri\GH17790-PA 458 GH17790-PA 61..226 98..280 223 29 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
upd3-PB 401 CG33542-PB 1..401 1..401 2070 100 Plus
os-PC 413 CG5993-PC 24..246 57..306 187 27.6 Plus
os-PB 413 CG5993-PB 24..246 57..306 187 27.6 Plus
os-PA 413 CG5993-PA 24..246 57..306 187 27.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 18:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15470-PA 790 GI15470-PA 500..770 101..390 456 38.9 Plus
Dmoj\GI15131-PA 380 GI15131-PA 117..288 92..280 195 28.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 18:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26967-PA 317 GL26967-PA 4..307 59..388 744 50.2 Plus
Dper\GL27044-PA 539 GL27044-PA 187..349 100..281 190 28.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 18:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22327-PA 382 GA22327-PA 1..357 1..388 775 48.2 Plus
Dpse\GA19283-PA 539 GA19283-PA 187..349 100..281 191 28.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 18:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22889-PA 452 GM22889-PA 40..452 2..401 1836 89.7 Plus
Dsec\GM22824-PA 401 GM22824-PA 49..232 80..280 174 27.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 18:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15648-PA 413 GD15648-PA 64..232 86..280 173 27.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 18:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19180-PA 338 GJ19180-PA 39..320 99..390 572 44.5 Plus
Dvir\GJ18988-PA 458 GJ18988-PA 73..236 100..280 210 28.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 18:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20003-PA 303 GK20003-PA 29..250 152..387 215 32.2 Plus
Dwil\GK19868-PA 445 GK19868-PA 83..245 100..280 165 29.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 18:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17718-PA 449 GE17718-PA 27..449 1..401 1427 74.6 Plus
Dyak\GE15539-PA 442 GE15539-PA 70..247 100..308 174 27.5 Plus

FI03911.hyp Sequence

Translation from 370 to 1575

> FI03911.hyp
MTTADRPLDVSRSSGSGSRSGNKTARTRNPVEPQPQPPFVDRRRRLNRNW
SLILLALAMSQFALSGGGCGVSAAPSHLATPPTDSPSSPINPTNPLKHLQ
KRSRAANFRLTFQQKLNASSTHLDWENTCNLKPTGLNETHSKAKRCKKRQ
RILQNLQNQTGRELRGIQAEDKARITTNADKLATVSTKTLDIVEKNKWRF
YKGNYRFLPRLNLTSKQLNLRHAHRDLQIYVGAFTYMRNIKLHWDLANLQ
AKSVLSDELGRMRKSAREVLCSVEEAINLTNLLYTPNRQRAPQPRGQKKR
RQAQPVVTYKILPRKLMEKRLQQFNSTLVPLVELHQQATLAARGEDVPPP
PDDLMVLEQHALFTKLKFVQYLKSIRKILANQRKSLCKATTHVPKAIQKK
L*

FI03911.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
upd3-PB 401 CG33542-PB 1..401 1..401 2070 100 Plus
os-PC 413 CG5993-PC 24..246 57..306 187 27.6 Plus
os-PB 413 CG5993-PB 24..246 57..306 187 27.6 Plus
os-PA 413 CG5993-PA 24..246 57..306 187 27.6 Plus