Clone FI03949 Report

Search the DGRC for FI03949

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:39
Well:49
Vector:pOT2
Associated Gene/TranscriptCG12182-RA
Protein status:FI03949.pep: gold
Sequenced Size:2372

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12182 2008-12-18 5.12 accounting

Clone Sequence Records

FI03949.complete Sequence

2372 bp assembled on 2008-08-15

GenBank Submission: BT044178.1

> FI03949.complete
TCGCTTTAAAATCGGCTGCACAAATTGTTTAGAATCTTACCATTTTCAAG
ACGCGGTCGAATCCATTGGACCCGCTGGCGTACTCGGACATCTGCTTCAC
AAAGTCCTTTGAAAAGAAAGAACTTCAGTTATCTACTCAACAAGTTACAT
GGTGCTCTAACCATTCCCAGTTTCTTGGCCGCCATTCCGGTGGATTTGGA
TTCCTGAACTGAGCACGACGAAATGACGAAAGTTACTGAGGGAGAAATTT
CACATGGCGTTCAAGATGTCGGGAAATATTATCTGGATTTTCACCTTCTA
GCCAAAGGATTCGTCCGCCAGGACTCGGTACACGACTTTGTAAACAGCGA
TTCCGATGGAGACTTTATAGCACTGAGCGGCTCCAAATCGGAAGTGATCA
CTCTGGAATTGAGCAGCAAGTTCATGGTCGTGGATCCCTTTCCGTATTTT
GTGGCCATTTATGATTCCAACGCTGCGGAAACACGACCTCTGGACGTTTT
GGCCAACAAAGTGGATCTGGTTGCCATATACGACAGCTGCGATGTCCTGG
AGGCACAGCACTTGGCCCTGGACCCGGCATACACGGCTGTGTGCTCCGTT
GCCGTGCCACCAGCCAGACTAACAGCTGTTAAGCGAGCACCCAAGCTGGC
AGCTAATGGAAATCTCCTCCTGGGCTCCCTCAACACTTATGGATCCTTGA
GCCTAATAAACAAGTCCGCTGAGTACAATCGTTGGAACCCTGTGGAAGGA
CTAAATATCGCTGAAACTCTGAGGGACACTCTGCTGCCTGAAGTGGACAT
CGCCAAGATAAAAGACTTTAAGAGCTATCAAGAATATATTAATCCCGCCT
GGATCACTATGTTTGCTTGGTTACCTGATGATGCAGATGCCACTGGCCAG
CATGTTTTGGTTCTGGGAACAGCCGCAGGAAGTTTGTGGTTGCTCACACT
AAGCGCCGATGTCAAAACTCTTTTAAGTCATCAAGAAACGAAAACCTCAA
TGGGTCGTATCTGCCATATACAAGCTTTCAAGGACCTTCTACTGGTGGGC
GATAGCAACGGACTCATTCACCTGTACCAATTGCCAGCTAAGGGAAATAC
AGCTCTCGCCTTAGTGAAGCCCTTGTGGGAGAAAGCCGATCGCATGGGTC
TGCAAATGGCAGTGATCACTGAATGTCCCAGAATGGATTGCTATTATATA
ACCTGCTGCAAGGCGGCGCACCTGCTGACCTGGAGCATGCCAAGAACGGG
GAGCACAGACTGCCTGCAAGCTCGGATCTATGTCGGCGGAATGAAGATCA
CCGCTCTCTGCAGCCTGGAGAACAGTAGCTACGTTGCAGGAACCGCTGGA
AGCTGTTTGTCTTGCGTACAAATTATCCACGAGAATAATCAGCTTAGCCT
GCAGATGCAATCGATAGCCATGGGTGTCCTTCAGGATTTCCAGGTGATGG
GACTGTGCACCAGTAGGCACAAGAACTTAATGACCCTGTTACTCTACCGC
AACAAGGAATATCTAAATGAAACTGTATCTCAAAAGAACCAGTTGGTTAT
GCAAGTGCTCAAGGTGGGGAATCAGGATCCACTTGATCAGCTTGTCAGGC
ATCTGGAATCCAATAAGCCCATGAATCACTATACCGATTTATTAGCTGGA
CTACGTCTGCACGTTTTTGCCGAGGAGAATTGGCAAAAATTTATGGACTT
TTGTCCATTAGATTCCATTGAATTTGCCGATACCGCCACTGAAGGTCAGC
TGCAGCAGCTGCAAATTAAATTTCATGTTCTTCAAAACGTGATTCGCCTG
CAATCGAGCCACCTCCAGCTGACAGTTCACATCCAAAAGTCCCGGGATGA
ACTGCAGCTGCTCCTTGCGATGCTGAATATCACACACATAAGACTGAGGC
TCCAGTTTATTGGGTCATTAAGTAAGAGATCACCATTCCAGGAGCAGGCG
ATAAAATGTATGTTCGAGGAGGCCCACAGACTGATAAATAAACTCAATGA
CGACTTCACGGAAAACCATGCCCTAGGATCCACAGCAAGGACATTCGTTG
AACAAATGGGCAACCATATTCAGCACTTGCACGAGATGCTAGGTATACCT
GTGATATCTAATCCCCAGAAGCAACTTCATCGATGCAGTGTGTCCTTTGT
GGAGATCTCCCTCAGCTTGGAGCGACGCTACTGCAGCCTCTGCAACCGCC
AAATCCTATTCGAGCTGGACAATCTGCAAGAACTCTACGAGTCGGGGAGA
CATCTGACATGTCCCGTTTGCCATGGAAGCTTTGCCACGGAAATGTTTAA
TGCATAAACGTTAAATTTATTCTCAATCTTAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

FI03949.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG12182-RA 2368 CG12182-RA 30..2361 1..2332 11660 100 Plus
CG16985-RA 649 CG16985-RA 1..80 240..161 400 100 Minus
CG16985-RA 649 CG16985-RA 79..145 107..41 335 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2596704..2598580 2154..278 9385 100 Minus
chr3L 24539361 chr3L 2598775..2599051 277..1 1385 100 Minus
chr3L 24539361 chr3L 2596477..2596654 2330..2153 890 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12182-RC 2085 CG12182-PC 1..2085 223..2307 10425 100 Plus
CG12182-RA 2085 CG12182-PA 1..2085 223..2307 10425 100 Plus
CG12182-RB 1884 CG12182-PB 1..1884 424..2307 9420 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:11:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12182-RC 3493 CG12182-RC 39..2368 1..2330 11650 100 Plus
CG12182-RA 2368 CG12182-RA 39..2368 1..2330 11650 100 Plus
CG12182-RB 2508 CG12182-RB 455..2508 277..2330 10270 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG12182-PC 694 CG12182-PC 1..694 223..2304 3487 100 Plus
CG12182-PA 694 CG12182-PA 1..694 223..2304 3487 100 Plus
CG12182-PB 627 CG12182-PB 1..627 424..2304 3147 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2597194..2599070 2154..278 9385 100 Minus
3L 28110227 3L 2599265..2599541 277..1 1385 100 Minus
3L 28110227 3L 2596965..2597144 2332..2153 900 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2597194..2599070 2154..278 9385 100 Minus
3L 28103327 3L 2599265..2599541 277..1 1385 100 Minus
3L 28103327 3L 2596965..2597144 2332..2153 900 100 Minus
Blast to na_te.dros performed on 2014-11-26 19:54:56 has no hits.

FI03949.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:40:36 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2598775..2599051 1..277 100   Minus
chr3L 2596704..2598580 278..2154 100 <- Minus
chr3L 2596477..2596652 2155..2330 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:46:58 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 1..2085 223..2307 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:19 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 1..2085 223..2307 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:39:28 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 1..2085 223..2307 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:30 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 1..2085 223..2307 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:40:36 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 1..2085 223..2307 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:29 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 1..2330 1..2330 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:19 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 1..2330 1..2330 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:39:28 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 39..2368 1..2330 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-15 15:26:41 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 1..2330 1..2330 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:40:36 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
CG12182-RA 39..2368 1..2330 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:40:36 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2599265..2599541 1..277 100   Minus
3L 2597194..2599070 278..2154 100 <- Minus
3L 2596967..2597142 2155..2330 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:39:28 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2599265..2599541 1..277 100   Minus
arm_3L 2597194..2599070 278..2154 100 <- Minus
arm_3L 2596967..2597142 2155..2330 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:36 Download gff for FI03949.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2599265..2599541 1..277 100   Minus
3L 2597194..2599070 278..2154 100 <- Minus
3L 2596967..2597142 2155..2330 100 <- Minus

FI03949.pep Sequence

Translation from 222 to 2306

> FI03949.pep
MTKVTEGEISHGVQDVGKYYLDFHLLAKGFVRQDSVHDFVNSDSDGDFIA
LSGSKSEVITLELSSKFMVVDPFPYFVAIYDSNAAETRPLDVLANKVDLV
AIYDSCDVLEAQHLALDPAYTAVCSVAVPPARLTAVKRAPKLAANGNLLL
GSLNTYGSLSLINKSAEYNRWNPVEGLNIAETLRDTLLPEVDIAKIKDFK
SYQEYINPAWITMFAWLPDDADATGQHVLVLGTAAGSLWLLTLSADVKTL
LSHQETKTSMGRICHIQAFKDLLLVGDSNGLIHLYQLPAKGNTALALVKP
LWEKADRMGLQMAVITECPRMDCYYITCCKAAHLLTWSMPRTGSTDCLQA
RIYVGGMKITALCSLENSSYVAGTAGSCLSCVQIIHENNQLSLQMQSIAM
GVLQDFQVMGLCTSRHKNLMTLLLYRNKEYLNETVSQKNQLVMQVLKVGN
QDPLDQLVRHLESNKPMNHYTDLLAGLRLHVFAEENWQKFMDFCPLDSIE
FADTATEGQLQQLQIKFHVLQNVIRLQSSHLQLTVHIQKSRDELQLLLAM
LNITHIRLRLQFIGSLSKRSPFQEQAIKCMFEEAHRLINKLNDDFTENHA
LGSTARTFVEQMGNHIQHLHEMLGIPVISNPQKQLHRCSVSFVEISLSLE
RRYCSLCNRQILFELDNLQELYESGRHLTCPVCHGSFATEMFNA*

FI03949.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:16:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10248-PA 696 GF10248-PA 1..696 1..694 1733 49.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14509-PA 695 GG14509-PA 1..695 1..694 3176 84.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15072-PA 687 GH15072-PA 1..687 1..694 1493 44.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG12182-PC 694 CG12182-PC 1..694 1..694 3603 100 Plus
CG12182-PA 694 CG12182-PA 1..694 1..694 3603 100 Plus
CG12182-PB 627 CG12182-PB 1..627 68..694 3263 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12840-PA 688 GI12840-PA 1..688 1..694 1371 42.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22624-PA 712 GL22624-PA 1..712 1..694 1632 45.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11461-PA 712 GA11461-PA 1..712 1..694 1635 45.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14114-PA 1046 GM14114-PA 371..1046 19..694 3381 92.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13383-PA 463 GD13383-PA 1..455 1..455 2323 94.1 Plus
Dsim\GD13384-PA 204 GD13384-PA 1..204 491..694 972 88.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12985-PA 679 GJ12985-PA 1..679 21..694 1358 45 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12505-PA 641 GK12505-PA 1..641 63..694 1295 42.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:16:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21700-PA 695 GE21700-PA 1..694 1..693 3152 84.3 Plus

FI03949.hyp Sequence

Translation from 222 to 2306

> FI03949.hyp
MTKVTEGEISHGVQDVGKYYLDFHLLAKGFVRQDSVHDFVNSDSDGDFIA
LSGSKSEVITLELSSKFMVVDPFPYFVAIYDSNAAETRPLDVLANKVDLV
AIYDSCDVLEAQHLALDPAYTAVCSVAVPPARLTAVKRAPKLAANGNLLL
GSLNTYGSLSLINKSAEYNRWNPVEGLNIAETLRDTLLPEVDIAKIKDFK
SYQEYINPAWITMFAWLPDDADATGQHVLVLGTAAGSLWLLTLSADVKTL
LSHQETKTSMGRICHIQAFKDLLLVGDSNGLIHLYQLPAKGNTALALVKP
LWEKADRMGLQMAVITECPRMDCYYITCCKAAHLLTWSMPRTGSTDCLQA
RIYVGGMKITALCSLENSSYVAGTAGSCLSCVQIIHENNQLSLQMQSIAM
GVLQDFQVMGLCTSRHKNLMTLLLYRNKEYLNETVSQKNQLVMQVLKVGN
QDPLDQLVRHLESNKPMNHYTDLLAGLRLHVFAEENWQKFMDFCPLDSIE
FADTATEGQLQQLQIKFHVLQNVIRLQSSHLQLTVHIQKSRDELQLLLAM
LNITHIRLRLQFIGSLSKRSPFQEQAIKCMFEEAHRLINKLNDDFTENHA
LGSTARTFVEQMGNHIQHLHEMLGIPVISNPQKQLHRCSVSFVEISLSLE
RRYCSLCNRQILFELDNLQELYESGRHLTCPVCHGSFATEMFNA*

FI03949.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG12182-PC 694 CG12182-PC 1..694 1..694 3603 100 Plus
CG12182-PA 694 CG12182-PA 1..694 1..694 3603 100 Plus
CG12182-PB 627 CG12182-PB 1..627 68..694 3263 100 Plus