Clone FI04402 Report

Search the DGRC for FI04402

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:2
Vector:pFlc-1
Associated Gene/TranscriptCG6766-RA
Protein status:FI04402.pep: gold
Sequenced Size:1921

Clone Sequence Records

FI04402.complete Sequence

1921 bp assembled on 2009-01-05

GenBank Submission: BT056256.1

> FI04402.complete
GTTCCTTATTTTTTTGAGAAAAACAACACGTAGCATTTGCAACTATTTGT
ATATTGTCACGAAAATACTCATGTAAAGAAATCGCTGCCTTAAACACGAA
AATGGGCAAGTCCTACGTGATAATTGCGAGAATAGCATTGCTGCTGAATT
TAATAATTGCAGCGGTTTCCCACGAAGCCAAAGATTTTGACGATTCAATT
TTGTATAAAATTGATTTCGAAGTGCCGGATTTAGATGTGCAGCCAAGCTT
GGGCAATCAGCTGCGAACATTCTACACGCCGGATAAGGAGAAGTACGACT
GCCTGATTCCCACTTTGGAACACCAAAAAGAGGAGGAAAAGTCCGACAAG
CCAGAGTTGTCTCCAATTACTCTGCTGCAGCCCATTTTCTCCGCCCTGAC
TTGCACGTACCGCATCGAGGCCTACTGGTCGTACGAAATCTGCCATGGCC
ACCATGTGCGTCAGTATCACGAGGAGCGCGAAGGAAAGAACGTCAAGTTC
CAGGAGTACTACCTGGGCAAATGGACCGATGAAAAGATGGAAATACTGAC
AAAAGCCTGGCAAGCAGACATCAAGGCGGGCGTTAAGCCGAAATACAAAA
GCCTGAAGATCGACAACACTCGGTATCCATACTTTGAGATGGAATACAGC
GATGGCACTATGTGCGACATAATTAACGCTCCTCGCACCACAATGGTGCG
TTATGTGTGCTATCCCCATGGTAAGAACGATATCTACTCCTTCAAGGAGA
CATCCTCGTGCAATTATGAGGCCATTATACTTTCCTCGGCGCTGTGCCCA
ATTCGCGCCCTTCATGCCGAAGAGACCAAGGAACTATCCATACAATGTTT
CAACTCCGAATCGAAACCGCACAGACCGCTGAGCATGCTGCGGTCGGAGC
TAAAGGAATGGGTTGAATCCGAGGCGGATCTGCTGGTTTTCAAGGAAAAG
GCTACGGAAAATCTGTGGCCCAAGACGGATGGCGATTTGGTCACCCTTAA
CTATGGCGGTGATATGGAAAAAGTCCTGCTCGAGCATTTCAGGAATGGTG
ACCTGAAGGTAGACGGAGACTTTCAGCAGCTCCTGCTGTCTATAGCAGCC
TCTGAAACTGGACCAACACCCATCACTGATCTGACGCCCCTTAAGGACTT
TATATCGGGCAAGAACTGCCTAACTGGGGGCAATGGCTGGTGGAAGTACG
AGTTCTGCTATGGCCGACATGTGCGTCAGTTCCACAAAGATAAGACCAGC
GAAGTGGAGCTCTTTCTTGGCTACTTCTCAGAGGAAGCGCATCGTGCTTG
GTCCAACGCCAACCCGGACAAGGGTGCACGCCGTTCCGGCTTCACGACAT
CCATCTGGCACCATTATGGCAAGGGAACCCACTGCGAACAGATTGGAGTG
CCCCGCGAAGTTGACGTGAAGTTAACCTGCACACCTGTAACGAACAGCGG
CACCGCTGTATCCATGTACCTGCTTGAGCCGAAGACGTGCCAGTATATCC
TGGTCGTGGAGTCGCCCACAATATGTGATCTCATCCACAACGCCGATTCC
CAGGGCCTAGTTAAACTGGAGAATCTGGACAAGATCTTGGTTACGGAAAC
CGATAAGTCGACTACCAGTTCCGCTTCCGCTCCTGCTCCAGCTCCAACTT
CCAGCACAGATGAGGAGAATCACCCATAGGCTGTCCGTGTATTCTAGTGA
ATTCCTATAAATACATTGATTGTAATATTACAATGCATTTGTATTTCAAT
TTGTAAAGTGGATGAAACCGATTTTAAAATTTAAGAACTCTGTTTCGGTC
TGATAGAATGTAATATAGAGATCTAAAATATTTATTCGTACAGTATTCGT
AAAGTATAAATTCAGGCTTTATTACAAAAAAAAGAAAAAAAAAAAAAAAA
AAAAAACGAAAAAAAAAAAAA

FI04402.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:44:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG6766-RA 2039 CG6766-RA 118..1995 1..1878 9360 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12038072..12038890 1179..361 4080 99.9 Minus
chr2L 23010047 chr2L 12037316..12038016 1878..1178 3460 99.6 Minus
chr2L 23010047 chr2L 12039126..12039370 245..1 1225 100 Minus
chr2L 23010047 chr2L 12038953..12039067 360..246 575 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG6766-RA 1578 CG6766-PA 1..1578 102..1679 7860 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG6766-RA 1882 CG6766-RA 8..1882 1..1875 9345 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:49:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG6766-PA 525 CG6766-PA 1..525 102..1676 2639 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12039384..12040202 1179..361 4095 100 Minus
2L 23513712 2L 12038628..12039328 1878..1178 3475 99.7 Minus
2L 23513712 2L 12040438..12040682 245..1 1225 100 Minus
2L 23513712 2L 12040265..12040379 360..246 575 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12039384..12040202 1179..361 4095 100 Minus
2L 23513712 2L 12038628..12039328 1878..1178 3475 99.7 Minus
2L 23513712 2L 12040438..12040682 245..1 1225 100 Minus
2L 23513712 2L 12040265..12040379 360..246 575 100 Minus
Blast to na_te.dros performed on 2014-11-27 05:49:32 has no hits.

FI04402.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:41:09 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12039126..12039370 1..245 100   Minus
chr2L 12038953..12039067 246..360 100 <- Minus
chr2L 12038073..12038890 361..1178 99 <- Minus
chr2L 12037319..12038015 1179..1875 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:07 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
CG6766-RA 1..1578 102..1679 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:22:13 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
CG6766-RA 1..1578 102..1679 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:54:57 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
CG6766-RA 1..1578 102..1679 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:41:09 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
CG6766-RA 1..1578 102..1679 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-05 17:18:41 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
CG6766-RA 1..1875 1..1875 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:22:13 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
CG6766-RA 1..1875 1..1875 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:54:57 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
CG6766-RA 8..1882 1..1875 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:41:09 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
CG6766-RA 8..1882 1..1875 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:41:09 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12040438..12040682 1..245 100   Minus
2L 12040265..12040379 246..360 100 <- Minus
2L 12039385..12040202 361..1178 100 <- Minus
2L 12038631..12039327 1179..1875 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:54:57 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12040438..12040682 1..245 100   Minus
arm_2L 12040265..12040379 246..360 100 <- Minus
arm_2L 12039385..12040202 361..1178 100 <- Minus
arm_2L 12038631..12039327 1179..1875 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:10:09 Download gff for FI04402.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12040438..12040682 1..245 100   Minus
2L 12040265..12040379 246..360 100 <- Minus
2L 12039385..12040202 361..1178 100 <- Minus
2L 12038631..12039327 1179..1875 99 <- Minus

FI04402.pep Sequence

Translation from 101 to 1678

> FI04402.pep
MGKSYVIIARIALLLNLIIAAVSHEAKDFDDSILYKIDFEVPDLDVQPSL
GNQLRTFYTPDKEKYDCLIPTLEHQKEEEKSDKPELSPITLLQPIFSALT
CTYRIEAYWSYEICHGHHVRQYHEEREGKNVKFQEYYLGKWTDEKMEILT
KAWQADIKAGVKPKYKSLKIDNTRYPYFEMEYSDGTMCDIINAPRTTMVR
YVCYPHGKNDIYSFKETSSCNYEAIILSSALCPIRALHAEETKELSIQCF
NSESKPHRPLSMLRSELKEWVESEADLLVFKEKATENLWPKTDGDLVTLN
YGGDMEKVLLEHFRNGDLKVDGDFQQLLLSIAASETGPTPITDLTPLKDF
ISGKNCLTGGNGWWKYEFCYGRHVRQFHKDKTSEVELFLGYFSEEAHRAW
SNANPDKGARRSGFTTSIWHHYGKGTHCEQIGVPREVDVKLTCTPVTNSG
TAVSMYLLEPKTCQYILVVESPTICDLIHNADSQGLVKLENLDKILVTET
DKSTTSSASAPAPAPTSSTDEENHP*

FI04402.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15494-PA 528 GF15494-PA 6..525 6..522 2136 74.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10283-PA 531 GG10283-PA 1..507 1..507 2450 88.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10202-PA 516 GH10202-PA 2..511 13..522 2008 72.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG6766-PA 525 CG6766-PA 1..525 1..525 2815 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14907-PA 514 GI14907-PA 12..508 18..514 2002 72.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14147-PA 529 GL14147-PA 1..522 1..521 1922 67.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19848-PA 529 GA19848-PA 1..522 1..521 1914 67.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26418-PA 521 GM26418-PA 1..521 1..525 2498 91.3 Plus
Dsec\GM16260-PA 376 GM16260-PA 1..376 146..525 1760 90.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22141-PA 519 GD22141-PA 1..519 1..525 2616 93 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24050-PA 515 GJ24050-PA 26..503 32..510 1962 73.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14829-PA 537 GK14829-PA 1..532 1..525 2048 71.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12511-PA 486 GE12511-PA 1..486 1..512 2316 84.2 Plus

FI04402.hyp Sequence

Translation from 101 to 1678

> FI04402.hyp
MGKSYVIIARIALLLNLIIAAVSHEAKDFDDSILYKIDFEVPDLDVQPSL
GNQLRTFYTPDKEKYDCLIPTLEHQKEEEKSDKPELSPITLLQPIFSALT
CTYRIEAYWSYEICHGHHVRQYHEEREGKNVKFQEYYLGKWTDEKMEILT
KAWQADIKAGVKPKYKSLKIDNTRYPYFEMEYSDGTMCDIINAPRTTMVR
YVCYPHGKNDIYSFKETSSCNYEAIILSSALCPIRALHAEETKELSIQCF
NSESKPHRPLSMLRSELKEWVESEADLLVFKEKATENLWPKTDGDLVTLN
YGGDMEKVLLEHFRNGDLKVDGDFQQLLLSIAASETGPTPITDLTPLKDF
ISGKNCLTGGNGWWKYEFCYGRHVRQFHKDKTSEVELFLGYFSEEAHRAW
SNANPDKGARRSGFTTSIWHHYGKGTHCEQIGVPREVDVKLTCTPVTNSG
TAVSMYLLEPKTCQYILVVESPTICDLIHNADSQGLVKLENLDKILVTET
DKSTTSSASAPAPAPTSSTDEENHP*

FI04402.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG6766-PA 525 CG6766-PA 1..525 1..525 2815 100 Plus