Clone FI04403 Report

Search the DGRC for FI04403

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:3
Vector:pFlc-1
Associated Gene/TranscriptCG10467-RA
Protein status:FI04403.pep: gold
Sequenced Size:1551

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10467 2008-12-18 5.12 accounting

Clone Sequence Records

FI04403.complete Sequence

1551 bp assembled on 2008-11-07

GenBank Submission: BT057986.1

> FI04403.complete
AACTCTAAAATTTGAATTGCAACTACGGCGATTAAAAGATAATTTAAGTA
AGAATTTTCTGAATTACCGCTAAATTTGGAATACGAACATTGCACAATTC
TTAAAGACTCCACAAGGTGTCTATCCCCCTTATCGCAGACTTTCCCACCA
ATTTGTGATAACTAGATCTGTTTATATATGTACGTACATATGTACATTTT
GTTTGCGGCTTTTTTGCGATAATTAAAACAAACACATACGCACATCGAGT
GCTGATTAACCTTTACGGCTTGGAGAGGGTCAGATAAAAACGCAGTGCAA
TTGGCACTCGTAATCATTCCACAGCTGCAGCCGGATCCAAAATGGTCAAC
GTCACGGAAGACGTCTTCGCCAACGGAGCGGTGAATCCGTTCACCAAGTC
AAAGGACACCATCAAGCGGTTCACCCTGACAAATGGAGCTGGAATGTCCG
TGCAATTGATCACCCGTGGAGCCACCATTACCAGCATAAAGACGCCTGAT
GCCAGCGGTCAAATAGATGACGTGACCCTCGGATTTGACGATTTGGCGGG
CTATCAGAGCGAGAGAAATCCGTATTTTGGAGCAACCATTGGGCGGGTTT
GCAACCGGATTGCCAATGGCAGCTTTTATCTTGATGGAAAGCTAGTTCAG
GTGTCTAAGAACCGAGACAACAAGTTTCAGCTCCATGGCGGCTTTGTAGG
CTTCGATAAGGCTCACTGGGAAGTTGTGGAAGTGCGTGTGGATGGTGTTA
CCCTGTCCCACACCAATCCCGATGGACACGAAGGCTATCCCGGCAAGGTG
ACAGCCACGGCAAGCTTTACCCTCAGCGAGGATAACTGCCTCCATGTCCA
GATGAGTGCACTAGCAGATAAAACCACTCCCGTGAATCTCACCAACCACT
CCTATTTCAACCTAGCTGGCCACAAATCTGGAGCCAACGGTCTCTACGAG
CACACCATCGAGATAAATGCTTATGGAATCACTGAGACGGATCAGTCTTC
CATTCCCACCGGCCGTATCACACCCGTAGAGGGAACAGGATTTGATTTAC
GTGTGTCCAGCAATCTGGGTGAACGCCTCAAGGCGCTGCAGCCAGCTCGC
GGCTACGATGACAACTTCTGTGTGACCTTCAGTCCACCACAACCATTGGC
CAAGGTGGCCAGAGCCACTCATCCGCCCAGCGGACGCTGGCTGGAGGTGG
TCAGCAATCAGCCCGGAGTGCAGTTCTACACCTCCAACTTTATGCCAGAC
GTGGAACGCGGTGAATCGCCCATTCCCGGCAAGGATGGAGCTGCCTATGC
CAAGCATTGTGCCTTCTGCCTGGAGACACAAAAGTTTCCCGACTCCGTGA
ACCACAGCAACTTTCCCTCGACCATTTTGCGACCTGGCGAAAGTTACCAG
CACGAAGTCATCTACAAGTTCGGAGTTTCTCACTGAGTGAGAATCTTATC
TTACTTATATATACGTATATGTACCATGTATCCGACTATTCAAGCAACCC
GTAATTATTATAACCAATAAACCAAAAGCACACAAAAAAAAAAAAAAAAA
A

FI04403.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG10467-RA 1533 CG10467-RA 1..1531 1..1531 7655 100 Plus
CG10467.a 1473 CG10467.a 1..855 1..855 4275 100 Plus
CG10467.a 1473 CG10467.a 856..1471 916..1531 3080 100 Plus
CG10469-RA 1190 CG10469-RA 1..231 1301..1531 1155 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6085865..6087396 1531..1 7370 98.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG10467-RA 1095 CG10467-PA 1..1095 342..1436 5475 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:19 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG10467-RA 1544 CG10467-RA 12..1542 1..1531 7655 100 Plus
CG10469-RA 1067 CG10469-RA 1..108 1424..1531 540 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG10467-PA 364 CG10467-PA 1..364 342..1433 1936 100 Plus
CG32445-PA 367 CG32445-PA 1..361 342..1424 943 49.3 Plus
CG32444-PA 370 CG32444-PA 3..358 345..1427 886 48.1 Plus
CG4988-PA 368 CG4988-PA 13..358 378..1427 864 47.9 Plus
CG10996-PA 392 CG10996-PA 1..365 342..1427 837 46.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6093206..6094736 1531..1 7655 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6086306..6087836 1531..1 7655 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:28:55 has no hits.

FI04403.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:30:39 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6085863..6087396 1..1533 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:47:33 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
CG10467-RA 1..1095 342..1436 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:20:02 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
CG10467-RA 1..1095 342..1436 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:01:45 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
CG10467-RA 1..1095 342..1436 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:30:39 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
CG10467-RA 1..1095 342..1436 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:01:00 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
CG10467-RA 1..1533 1..1533 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:20:02 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
CG10467-RA 1..1533 1..1533 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:01:45 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
CG10467-RA 12..1544 1..1533 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-07 17:04:21 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
CG10467-RA 1..1533 1..1533 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:30:39 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
CG10467-RA 12..1544 1..1533 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:30:39 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6093204..6094736 1..1533 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:01:45 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6086304..6087836 1..1533 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:51:25 Download gff for FI04403.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6086304..6087836 1..1533 99   Minus

FI04403.pep Sequence

Translation from 341 to 1435

> FI04403.pep
MVNVTEDVFANGAVNPFTKSKDTIKRFTLTNGAGMSVQLITRGATITSIK
TPDASGQIDDVTLGFDDLAGYQSERNPYFGATIGRVCNRIANGSFYLDGK
LVQVSKNRDNKFQLHGGFVGFDKAHWEVVEVRVDGVTLSHTNPDGHEGYP
GKVTATASFTLSEDNCLHVQMSALADKTTPVNLTNHSYFNLAGHKSGANG
LYEHTIEINAYGITETDQSSIPTGRITPVEGTGFDLRVSSNLGERLKALQ
PARGYDDNFCVTFSPPQPLAKVARATHPPSGRWLEVVSNQPGVQFYTSNF
MPDVERGESPIPGKDGAAYAKHCAFCLETQKFPDSVNHSNFPSTILRPGE
SYQHEVIYKFGVSH*

FI04403.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10927-PA 364 GF10927-PA 1..362 1..362 1724 87.3 Plus
Dana\GF25159-PA 367 GF25159-PA 1..361 1..361 975 51 Plus
Dana\GF25157-PA 377 GF25157-PA 3..366 2..363 961 49.3 Plus
Dana\GF19091-PA 388 GF19091-PA 1..366 1..363 805 43.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:19:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14088-PA 364 GG14088-PA 1..364 1..364 1868 95.1 Plus
Dere\GG16212-PA 367 GG16212-PA 1..361 1..361 951 49 Plus
Dere\GG16211-PA 374 GG16211-PA 3..358 2..362 900 47.8 Plus
Dere\GG19484-PA 391 GG19484-PA 1..366 1..363 849 45.5 Plus
Dere\GG23731-PA 368 GG23731-PA 15..358 15..362 824 45.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15657-PA 364 GH15657-PA 1..364 1..364 1503 74 Plus
Dgri\GH16364-PA 367 GH16364-PA 1..361 1..361 993 49.9 Plus
Dgri\GH16361-PA 375 GH16361-PA 3..364 2..362 947 49.6 Plus
Dgri\GH11905-PA 389 GH11905-PA 1..365 1..362 882 44.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG10467-PA 364 CG10467-PA 1..364 1..364 1936 100 Plus
CG32445-PA 367 CG32445-PA 1..361 1..361 943 49.3 Plus
CG32444-PA 370 CG32444-PA 3..358 2..362 886 48.1 Plus
CG4988-PA 368 CG4988-PA 13..358 13..362 864 47.9 Plus
CG10996-PA 392 CG10996-PA 1..365 1..362 837 46.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12703-PA 363 GI12703-PA 1..360 1..361 1476 74 Plus
Dmoj\GI11556-PA 367 GI11556-PA 1..361 1..361 949 48.2 Plus
Dmoj\GI11552-PA 377 GI11552-PA 3..368 2..364 941 48.9 Plus
Dmoj\GI21479-PA 388 GI21479-PA 1..365 1..363 854 42.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15523-PA 365 GL15523-PA 1..348 1..348 1583 83.6 Plus
Dper\GL24849-PA 376 GL24849-PA 3..366 2..363 952 49 Plus
Dper\GL24851-PA 369 GL24851-PA 1..363 1..361 825 45.8 Plus
Dper\GL20398-PA 390 GL20398-PA 1..367 1..363 817 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10332-PA 364 GA10332-PA 1..364 1..364 1664 84.3 Plus
Dpse\GA16910-PA 367 GA16910-PA 1..361 1..361 1015 52.3 Plus
Dpse\GA16909-PA 376 GA16909-PA 3..366 2..363 952 49 Plus
Dpse\GA29171-PA 390 GA29171-PA 1..367 1..363 806 42.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13871-PA 364 GM13871-PA 1..364 1..364 1907 97.8 Plus
Dsec\GM22394-PA 367 GM22394-PA 1..361 1..361 950 48.8 Plus
Dsec\GM22392-PA 370 GM22392-PA 3..358 2..362 908 48.1 Plus
Dsec\GM19161-PA 368 GM19161-PA 15..358 15..362 869 47.9 Plus
Dsec\GM17584-PA 392 GM17584-PA 1..366 1..363 857 46.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13155-PA 364 GD13155-PA 1..364 1..364 1919 97.8 Plus
Dsim\GD14983-PA 367 GD14983-PA 1..361 1..361 950 48.8 Plus
Dsim\GD14982-PA 370 GD14982-PA 3..358 2..362 908 48.1 Plus
Dsim\GD23786-PA 368 GD23786-PA 15..358 15..362 883 48.4 Plus
Dsim\GD15872-PA 411 GD15872-PA 1..367 1..362 809 44.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12686-PA 363 GJ12686-PA 1..360 1..361 1497 74.2 Plus
Dvir\GJ11129-PA 367 GJ11129-PA 1..361 1..361 994 50.7 Plus
Dvir\GJ11234-PA 367 GJ11234-PA 1..361 1..361 994 50.7 Plus
Dvir\GJ11231-PA 377 GJ11231-PA 3..367 2..363 959 50.3 Plus
Dvir\GJ18510-PA 388 GJ18510-PA 1..365 1..363 888 45.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:19:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16927-PA 367 GK16927-PA 1..362 1..362 1481 74 Plus
Dwil\GK17052-PA 367 GK17052-PA 1..361 1..361 949 47.4 Plus
Dwil\GK17132-PA 376 GK17132-PA 3..367 2..363 944 49.2 Plus
Dwil\GK25047-PA 393 GK25047-PA 1..368 1..363 816 41.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:19:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20511-PA 364 GE20511-PA 1..364 1..364 1900 96.7 Plus
Dyak\GE23042-PA 367 GE23042-PA 1..361 1..361 951 49 Plus
Dyak\GE19781-PA 367 GE19781-PA 1..361 1..361 951 49 Plus
Dyak\GE23041-PA 370 GE23041-PA 3..358 2..362 921 49.2 Plus
Dyak\GE19780-PA 370 GE19780-PA 3..358 2..362 921 49.2 Plus

FI04403.hyp Sequence

Translation from 341 to 1435

> FI04403.hyp
MVNVTEDVFANGAVNPFTKSKDTIKRFTLTNGAGMSVQLITRGATITSIK
TPDASGQIDDVTLGFDDLAGYQSERNPYFGATIGRVCNRIANGSFYLDGK
LVQVSKNRDNKFQLHGGFVGFDKAHWEVVEVRVDGVTLSHTNPDGHEGYP
GKVTATASFTLSEDNCLHVQMSALADKTTPVNLTNHSYFNLAGHKSGANG
LYEHTIEINAYGITETDQSSIPTGRITPVEGTGFDLRVSSNLGERLKALQ
PARGYDDNFCVTFSPPQPLAKVARATHPPSGRWLEVVSNQPGVQFYTSNF
MPDVERGESPIPGKDGAAYAKHCAFCLETQKFPDSVNHSNFPSTILRPGE
SYQHEVIYKFGVSH*

FI04403.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG10467-PA 364 CG10467-PA 1..364 1..364 1936 100 Plus
CG32445-PA 367 CG32445-PA 1..361 1..361 943 49.3 Plus
CG32444-PA 370 CG32444-PA 3..358 2..362 886 48.1 Plus
CG4988-PA 368 CG4988-PA 13..358 13..362 864 47.9 Plus
CG10996-PA 392 CG10996-PA 1..365 1..362 837 46.2 Plus