Clone FI04408 Report

Search the DGRC for FI04408

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:8
Vector:pFlc-1
Associated Gene/TranscriptRox8-RD
Protein status:FI04408.pep: gold
Sequenced Size:2955

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Rox8 2008-12-18 5.12 accounting

Clone Sequence Records

FI04408.complete Sequence

2955 bp assembled on 2008-11-04

GenBank Submission: BT050464.1

> FI04408.complete
GAGTGTGTTAGAGAGAGAAAGCGGTGATGCAAGCGTTATCGCCTGCCCTA
GGGTTGCCCCCTTTTCGATAACGTTGCTTCAAATAACTTAAAGTCGCGAA
TTAATGTGTGATCCTTGTCATATTATCGCTGAATTTCCATTAAATACCCC
TACCAGCAACGATTCCAGGGGTCAGCTTCGAAACCCGAAAAGTACACTCA
GCCTGCGAACTTTCACGCTGTTTAACTTAGCTAACTAATTTTTGTACAAG
AGCAAGAATAAGTAGTCGCAACCAAGTATTCATATGTACATTTATACAAT
CCTGTATATTGGAACGGACAACTATTTATAATCACAACAACAACATCCGG
ATCATCGAAGAAGGATCGAGCAATTCTGAAATACCAAGTAGTGTACACCA
AGAAACCCCGAATCCAAATCCCAGGCCCCCAGGAAAGGAAGTCAACCGAT
TATAGACATATATATTAGGCGACTAATCGTATATTCCAAAACACTCCATT
AGCGTTTAGTTAGGACAGATATATTTATACGTATACATATAGATGTTTAA
CGAAATTTTCAATTAGGCGCCAGATTAGGAACAAAATAAAGCAATAAACG
ACGAACCTCAGCGTTAAGCAAATAGATCAACCTACCTAGATTGAGCATAT
AAAGTTTATATAATCCAAAAAAATCAAGCCAAGCCGAGAGTAAGTCGAAA
GTAGTAGAAAATCAAAGTATTCAAATCTCTCTTGGAGTTTCCTGTTAGCA
GCTAGCACCAATTAGATTGCCGCAAATACACCTGTTTAATTAGCAGACAC
TTTAGATTTTGTACGTAGCTAGGAACTTAATCTGCAAATTTTTGATACAT
CCCCTTCCGATTAATGCGGCCAGGTGCAGTAGTTGCAATTCCGGTTTTAG
TGTAGAGTCAGTAGATTGTCGCTGTAGCCTAGTGTATAATCAGATCAAAA
AAGCCACAGTCCCGTGACATCCGACAGCCATGGACGAGTCGCAACCGAAG
ACCCTATACGTGGGCAACCTGGATAGCTCAGTGTCCGAGGACCTGCTAAT
TGCCCTCTTCAGCACCATGGGGCCCGTCAAAAGCTGCAAAATCATTCGGG
AACCGGGCAACGATCCATATGCCTTCATCGAATATTCCAACTACCAGGCA
GCCACAACAGCTCTGACCGCCATGAATAAACGCCTATTCCTCGAAAAGGA
AATCAAGGTCAACTGGGCCACCAGTCCCGGCAATCAGCCGAAGACAGACA
TCAGTTCGCACCACCACATATTCGTGGGCGACCTCAGTCCCGAGATTGAG
ACAGAAACACTGCGCGAGGCTTTCGCCCCATTCGGAGAGATCTCCAACTG
TCGCATTGTGCGCGACCCTCACACCATGAAGTCAAAGGGTTACGCCTTCG
TGTCGTTTGTGAAAAAGGCGGAGGCAGAGAACGCCATCCAGGCGATGAAC
GGCCAGTGGATTGGCTCGCGCTCGATACGCACCAACTGGTCCACGCGCAA
GCTGCCACCACCACGCGAGCCTTCCAAGGGCGGAGGCCAGGGAGGCGGAA
TGGGTGGCGGACCGGGCAATGGGTCCGGTGTAAAGGGAAGTCAACGCCAC
ACCTTCGAGGAAGTGTATAACCAGTCGAGCCCCACCAACACCACCGTATA
CTGTGGCGGATTCCCGCCGAATGTCATCAGTGACGACCTGATGCACAAGC
ACTTCGTCCAGTTTGGTCCCATCCAGGACGTGCGGGTCTTCAAGGACAAG
GGCTTCTCGTTCATCAAGTTTGTTACCAAGGAGGCAGCCGCCCACGCCAT
CGAGCACACGCACAACAGCGAGGTACATGGAAACCTGGTAAAGTGCTTCT
GGGGCAAAGAGAACGGAGGCGATAACTCGGCCAATAACCTCAATGCCGCC
GCTGCCGCGGCAGCAGCCTCTGCCAATGTTGCCGCCGTTGCGGCAGCCAA
TGCTGCGGTTGCCGCTGGAGCGGGTATGCCCGGTCAGATGATGACGCAGC
AACAGATCGCCGCCGCAACAGGAGCGGCGATACCCGGCCAAATGATGACA
CCCCAGCAGATTGCGGCGCAGTATCCATACGCGTACCAGCAGATGGGCTA
CTGGTATCCACCTGCGACTTATCCCACAACCCAGATGCAGACGCAATACA
TGCAGCAGGGCTACTATCCCTACGCCTACCCTACCAGTGCTCAGCAAGCG
GGAGGAGTCCCTTGCATACAATTTTCAGCGGCTGGATACCGCATGGTGCC
GCCGAATGTAGCATGGGGCGTGCCCGGAACTGTGGTGCCCGGTGTGACGG
CTGCCGCAGCATCCGCGGCCGCTGCAGCGAACGGATCACTTGCCCCCCAA
ATGATGTACAGTGCTGCGATGCCACAATACCAGACCCAATGAGCTGAGAT
GTGACGCCAGCTTCGACGCCGTTTGCAGCATCCGGGAAGTCGCCCCCAGC
CGCAGCCACAACCACCTCTGCTGCATCAGCTTCCGCACCTGCAGCAGTTG
CAAGCGCATTACGCACGTTTAGGTTACGTACAATACCGAGTAGTAGCAAA
GTCGGAGCCGCTCCTGGCCATGCCGTTGACCAGCGGCAGCAGCCACATTG
ACGGTGGCAATGTATCTGGAGATTATTAAGGATGCGCGAGTGTCCACTTT
GAAGTTGTGGCTACGGTTGCGGCTGACTGCGGTGGAAGGAAGCGGAATCG
GGTGTGGTATATAGCCCCCCAAAGTCGAACGTTAAGGCGGTGCGTGGAGC
TCAACTTCAAGTGATCCACGCCGGCGACAACTGAAAGAACATCAATTGAA
AAGCTCCGGGCGATGGGCGGGTAGCTGTAACAATCTAATCCAATCTAAGT
ACGTGTTAAATTAATTTAATGATTTCTAATTTAAGCAGATATAGGCGTAT
AAACGAAACGGAAATAAAATAAACCGAATGAGAAATTCAAAAAAAAAAAA
AAAAA

FI04408.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Rox8-RD 3292 Rox8-RD 1..2954 1..2954 14725 99.8 Plus
Rox8.d 3274 Rox8.d 1..2211 1..2211 11055 100 Plus
Rox8.k 3388 Rox8.k 268..2325 154..2211 10290 100 Plus
Rox8.d 3274 Rox8.d 2211..2936 2229..2954 3585 99.5 Plus
Rox8.k 3388 Rox8.k 2325..3050 2229..2954 3585 99.5 Plus
Rox8.k 3388 Rox8.k 1..71 85..155 355 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19868838..19869893 1209..154 5205 99.5 Minus
chr3R 27901430 chr3R 19867760..19868670 2116..1206 4525 99.8 Minus
chr3R 27901430 chr3R 19866808..19867547 2938..2211 3440 98 Minus
chr3R 27901430 chr3R 19871522..19871674 153..1 750 99.3 Minus
chr3R 27901430 chr3R 19867599..19867693 2210..2116 460 98.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Rox8-RH 1413 CG5422-PH 1..1413 980..2392 7065 100 Plus
Rox8-RG 1413 CG5422-PG 1..1413 980..2392 7065 100 Plus
Rox8-RE 1413 CG5422-PE 1..1413 980..2392 7065 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:24 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Rox8-RD 3300 CG5422-RD 1..2938 1..2938 14690 100 Plus
Rox8-RE 3222 CG5422-RE 75..2860 153..2938 13930 100 Plus
Rox8-RH 3370 CG5422-RH 224..3008 154..2938 13925 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Rox8-PH 470 CG5422-PH 1..470 980..2389 1625 100 Plus
Rox8-PG 470 CG5422-PG 1..470 980..2389 1625 100 Plus
Rox8-PE 470 CG5422-PE 1..470 980..2389 1625 100 Plus
Rox8-PD 470 CG5422-PD 1..470 980..2389 1625 100 Plus
Rox8-PC 464 CG5422-PC 1..464 980..2389 1576 98.7 Plus
Rox8-PH 470 CG5422-PH 76..291 941..1489 169 23 Plus
Rox8-PG 470 CG5422-PG 76..291 941..1489 169 23 Plus
Rox8-PE 470 CG5422-PE 76..291 941..1489 169 23 Plus
Rox8-PD 470 CG5422-PD 76..291 941..1489 169 23 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24045436..24046491 1209..154 5280 100 Minus
3R 32079331 3R 24044358..24045268 2116..1206 4555 100 Minus
3R 32079331 3R 24043402..24044145 2954..2211 3675 99.6 Minus
3R 32079331 3R 24048113..24048265 153..1 765 100 Minus
3R 32079331 3R 24044197..24044291 2210..2116 475 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23786267..23787322 1209..154 5280 100 Minus
3R 31820162 3R 23785189..23786099 2116..1206 4555 100 Minus
3R 31820162 3R 23784233..23784976 2954..2211 3675 99.5 Minus
3R 31820162 3R 23788944..23789096 153..1 765 100 Minus
3R 31820162 3R 23785028..23785122 2210..2116 475 100 Minus
Blast to na_te.dros performed on 2014-11-27 02:15:31 has no hits.

FI04408.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:51:16 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19871522..19871674 1..153 99   Minus
chr3R 19868840..19869893 154..1207 99 <- Minus
chr3R 19867982..19868668 1208..1894 99 <- Minus
chr3R 19867760..19867908 1968..2116 100 == Minus
chr3R 19867599..19867692 2117..2210 98 <- Minus
chr3R 19866808..19867547 2211..2938 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:47:36 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RD 1..1413 980..2392 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:18:01 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RD 1..1413 980..2392 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:42:16 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RE 1..1413 980..2392 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:51:16 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RE 1..1413 980..2392 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:13 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RD 1..2938 1..2938 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:18:01 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RD 1..2938 1..2938 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:42:16 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RD 1..2938 1..2938 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 12:27:42 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RD 1..2938 1..2938 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:51:16 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
Rox8-RD 1..2938 1..2938 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:51:16 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24048113..24048265 1..153 100   Minus
3R 24045438..24046491 154..1207 100 <- Minus
3R 24044358..24045266 1208..2116 100 <- Minus
3R 24044197..24044290 2117..2210 100 <- Minus
3R 24043418..24044145 2211..2938 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:42:16 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19873835..19873987 1..153 100   Minus
arm_3R 19871160..19872213 154..1207 100 <- Minus
arm_3R 19870080..19870988 1208..2116 100 <- Minus
arm_3R 19869919..19870012 2117..2210 100 <- Minus
arm_3R 19869140..19869867 2211..2938 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:11 Download gff for FI04408.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23788944..23789096 1..153 100   Minus
3R 23786269..23787322 154..1207 100 <- Minus
3R 23785189..23786097 1208..2116 100 <- Minus
3R 23785028..23785121 2117..2210 100 <- Minus
3R 23784249..23784976 2211..2938 100 <- Minus

FI04408.pep Sequence

Translation from 979 to 2391

> FI04408.pep
MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFI
EYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHHIFVG
DLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAE
NAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSG
VKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQD
VRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGDNS
ANNLNAAAAAAAASANVAAVAAANAAVAAGAGMPGQMMTQQQIAAATGAA
IPGQMMTPQQIAAQYPYAYQQMGYWYPPATYPTTQMQTQYMQQGYYPYAY
PTSAQQAGGVPCIQFSAAGYRMVPPNVAWGVPGTVVPGVTAAAASAAAAA
NGSLAPQMMYSAAMPQYQTQ*

FI04408.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17967-PA 471 GF17967-PA 1..471 1..470 1909 91 Plus
Dana\GF18875-PA 495 GF18875-PA 165..357 96..308 639 55.8 Plus
Dana\GF18877-PA 240 GF18877-PA 1..171 123..313 498 51.5 Plus
Dana\GF20385-PA 341 GF20385-PA 8..180 2..174 259 33.9 Plus
Dana\GF12652-PA 639 GF12652-PA 3..241 8..275 241 26.1 Plus
Dana\GF18875-PA 495 GF18875-PA 166..340 9..170 215 27.6 Plus
Dana\GF18877-PA 240 GF18877-PA 1..159 35..177 181 28.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12380-PA 464 GG12380-PA 1..464 1..470 2047 97.7 Plus
Dere\GG11588-PA 502 GG11588-PA 171..363 96..308 637 55.8 Plus
Dere\GG11590-PA 414 GG11590-PA 108..283 118..310 500 50 Plus
Dere\GG19577-PA 339 GG19577-PA 8..180 2..174 258 33.9 Plus
Dere\GG21846-PA 635 GG21846-PA 3..241 8..275 238 26.8 Plus
Dere\GG11588-PA 502 GG11588-PA 172..346 9..170 213 27.6 Plus
Dere\GG11590-PA 414 GG11590-PA 114..280 36..186 187 28.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19101-PA 476 GH19101-PA 1..476 1..470 1732 81.2 Plus
Dgri\GH17439-PA 520 GH17439-PA 179..367 96..304 639 55.9 Plus
Dgri\GH17442-PA 322 GH17442-PA 21..227 123..383 501 43.4 Plus
Dgri\GH17589-PA 340 GH17589-PA 8..180 2..174 265 34.5 Plus
Dgri\GH21052-PA 645 GH21052-PA 3..241 8..275 232 26.1 Plus
Dgri\GH17439-PA 520 GH17439-PA 180..354 9..170 204 27.1 Plus
Dgri\GH17442-PA 322 GH17442-PA 1..172 9..170 201 27.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Rox8-PH 470 CG5422-PH 1..470 1..470 2487 100 Plus
Rox8-PG 470 CG5422-PG 1..470 1..470 2487 100 Plus
Rox8-PE 470 CG5422-PE 1..470 1..470 2487 100 Plus
Rox8-PD 470 CG5422-PD 1..470 1..470 2487 100 Plus
Rox8-PC 464 CG5422-PC 1..464 1..470 2438 98.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22960-PA 475 GI22960-PA 1..475 1..470 1799 84.3 Plus
Dmoj\GI22766-PA 387 GI22766-PA 46..234 96..304 634 55.9 Plus
Dmoj\GI22767-PA 315 GI22767-PA 76..281 123..383 497 44.7 Plus
Dmoj\GI16317-PA 340 GI16317-PA 8..180 2..174 264 34.5 Plus
Dmoj\GI18654-PA 645 GI18654-PA 3..241 8..275 233 25.7 Plus
Dmoj\GI22766-PA 387 GI22766-PA 47..221 9..170 215 27.6 Plus
Dmoj\GI22767-PA 315 GI22767-PA 76..227 35..170 181 29.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:55:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24152-PA 464 GL24152-PA 1..464 1..470 1896 87.6 Plus
Dper\GL23648-PA 503 GL23648-PA 171..361 94..304 643 55.9 Plus
Dper\GL23650-PA 320 GL23650-PA 76..246 123..313 499 52.1 Plus
Dper\GL21313-PA 341 GL21313-PA 8..180 2..174 258 33.9 Plus
Dper\GL11548-PA 640 GL11548-PA 92..352 9..287 230 24.6 Plus
Dper\GL23648-PA 503 GL23648-PA 174..348 9..170 212 27.1 Plus
Dper\GL23650-PA 320 GL23650-PA 75..227 34..170 176 28.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18869-PA 464 GA18869-PA 1..464 1..470 1896 87.6 Plus
Dpse\GA26680-PA 503 GA26680-PA 171..361 94..304 643 55.9 Plus
Dpse\GA30124-PA 464 GA30124-PA 113..336 105..383 581 47.5 Plus
Dpse\GA17684-PA 341 GA17684-PA 8..180 2..174 259 33.9 Plus
Dpse\GA18673-PA 640 GA18673-PA 3..241 8..275 227 26.1 Plus
Dpse\GA26680-PA 503 GA26680-PA 174..348 9..170 212 27.1 Plus
Dpse\GA30124-PA 464 GA30124-PA 106..282 13..170 195 27.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:55:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23518-PA 464 GM23518-PA 1..464 1..470 2052 97.9 Plus
Dsec\GM16370-PA 504 GM16370-PA 166..358 96..308 636 55.8 Plus
Dsec\GM16372-PA 246 GM16372-PA 1..178 115..313 498 51 Plus
Dsec\GM12470-PA 299 GM12470-PA 8..180 2..174 254 33.3 Plus
Dsec\GM21847-PA 634 GM21847-PA 3..241 8..275 232 26.4 Plus
Dsec\GM16370-PA 504 GM16370-PA 167..341 9..170 211 27.6 Plus
Dsec\GM16372-PA 246 GM16372-PA 6..175 33..186 186 27.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18328-PA 824 GD18328-PA 1..357 1..379 1691 92.6 Plus
Dsim\GD21364-PA 496 GD21364-PA 165..357 96..308 637 55.8 Plus
Dsim\GD21365-PA 363 GD21365-PA 98..295 96..313 615 54.8 Plus
Dsim\GD11341-PA 379 GD11341-PA 3..241 8..275 224 26.4 Plus
Dsim\GD21365-PA 363 GD21365-PA 99..292 9..186 221 27.5 Plus
Dsim\GD21364-PA 496 GD21364-PA 166..340 9..170 213 27.6 Plus
Dsim\GD11341-PA 379 GD11341-PA 92..352 9..287 206 24.6 Plus
Dsim\GD16475-PA 466 GD16475-PA 147..295 9..158 205 32.5 Plus
Dsim\GD11341-PA 379 GD11341-PA 185..365 9..174 165 25.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:55:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14540-PA 472 GJ14540-PA 1..472 1..470 1839 84.6 Plus
Dvir\GJ22768-PA 504 GJ22768-PA 170..371 94..315 652 54.5 Plus
Dvir\GJ22770-PA 401 GJ22770-PA 66..300 94..383 621 48.1 Plus
Dvir\GJ15655-PA 340 GJ15655-PA 8..180 2..174 264 34.5 Plus
Dvir\GJ21671-PA 645 GJ21671-PA 3..241 8..275 233 26.1 Plus
Dvir\GJ22770-PA 401 GJ22770-PA 69..246 9..170 218 28.3 Plus
Dvir\GJ22768-PA 504 GJ22768-PA 173..347 9..170 216 27.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11939-PA 469 GK11939-PA 1..469 1..470 1882 88.2 Plus
Dwil\GK22641-PA 521 GK22641-PA 182..370 96..304 638 56.4 Plus
Dwil\GK22643-PA 365 GK22643-PA 1..171 123..313 503 52.1 Plus
Dwil\GK19717-PA 339 GK19717-PA 8..180 2..174 262 33.9 Plus
Dwil\GK19652-PA 638 GK19652-PA 3..241 8..275 234 26.1 Plus
Dwil\GK22641-PA 521 GK22641-PA 183..357 9..170 205 26 Plus
Dwil\GK22643-PA 365 GK22643-PA 1..152 35..170 178 28.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10834-PA 464 GE10834-PA 1..464 1..470 2043 97.7 Plus
Dyak\GE23777-PA 543 GE23777-PA 208..404 92..308 642 55.3 Plus
Dyak\GE23778-PA 269 GE23778-PA 1..138 156..313 357 46.6 Plus
Dyak\GE16738-PA 339 GE16738-PA 8..180 2..174 257 33.9 Plus
Dyak\GE11925-PA 634 GE11925-PA 3..241 8..275 233 26.4 Plus
Dyak\GE23777-PA 543 GE23777-PA 213..387 9..170 214 27.6 Plus

FI04408.hyp Sequence

Translation from 979 to 2391

> FI04408.hyp
MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFI
EYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHHIFVG
DLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAE
NAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSG
VKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQD
VRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGDNS
ANNLNAAAAAAAASANVAAVAAANAAVAAGAGMPGQMMTQQQIAAATGAA
IPGQMMTPQQIAAQYPYAYQQMGYWYPPATYPTTQMQTQYMQQGYYPYAY
PTSAQQAGGVPCIQFSAAGYRMVPPNVAWGVPGTVVPGVTAAAASAAAAA
NGSLAPQMMYSAAMPQYQTQ*

FI04408.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Rox8-PH 470 CG5422-PH 1..470 1..470 2487 100 Plus
Rox8-PG 470 CG5422-PG 1..470 1..470 2487 100 Plus
Rox8-PE 470 CG5422-PE 1..470 1..470 2487 100 Plus
Rox8-PD 470 CG5422-PD 1..470 1..470 2487 100 Plus
Rox8-PC 464 CG5422-PC 1..464 1..470 2438 98.7 Plus