Clone FI04417 Report

Search the DGRC for FI04417

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:17
Vector:pFlc-1
Associated Gene/TranscriptCG32473-RA
Protein status:FI04417.pep: gold
Sequenced Size:3284

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32473 2008-12-18 5.12 accounting

Clone Sequence Records

FI04417.complete Sequence

3284 bp assembled on 2008-09-19

GenBank Submission: BT044555.1

> FI04417.complete
AGTTTCCAATTTGGCTTCCAGCCTAGTGGAAGCAGTCGAGTAATTTTCAT
CGAAAAAAGAATATCCCTAAAAATGGTTGCCTGGCTGACGGTTAAGTCAG
TGGCCATCTTTTTGGGCCTGGCCTCTACTGCTTTTTGTGTGGCCACGATT
GTGCTGGCCGTTCAGAATGCGGACCTGGAGAACGATCTGCAGGATGCCCT
CGATAAGATCGACGCATTGACGGTGGACACCACGTCCACGTCCTCCACCT
CTACCAGCACTTCCACGACCACCACCACTGCAAATCCCAATGGGCCCACG
GATGACACCGAGCCTGGCTCTACCACCACACCTGGCGTAGGAGGTGACAC
AACCCCCAGTGCAGGAACATCTCCGGGTGGTGAAACTTCGCCATCATCCA
GTACAGGAAGCACCACCAATCCCATCTATCCGACATTGCCGACAGGACTT
CCTGATCCTGAAAAGATCGAATGGCGCCTGCCCACGGAACTGACGCCCAT
CAAGTACAAGGTGTACTACCATCCCGACTTGACGACCGGCGCCTGTGAGG
GAACCGTGTCCATTCAGTTCCAGCTGAACGCGATCACCAACCTGATCGTC
CTGCACGCCAAGGAGCTCAATGTGCACAGCATCAGCATCCTGAACATGAT
GGCGCGCATACGCGTGGCCATCGATAGCATCAACTTGGATGAGTCCCGGG
AGCTGCTCCTGATCACGCTAAGAGAGGTCCTCAGTATGAACAAGGCCTAC
ACACTGTCCGCAAGTTTCGACTGCGATCTGAGCAGTCTGGTGGGCAGCTA
CATCAGCAACTACACGAATGCCGATGGAGTAGATAGATCAATCATTTCCA
CAAAGTTTGAGCCCACTTATGCCCGCCAAGCATTCCCCTGCTTCGATGAG
CCCGCCCTTAAGGCTCAGTTCACCATAACGGTGGCCCGTCCAAGTGGTGA
TGAGTACCATGTGCTGTCCAACATGCCAGTGGCCAGCGAGTATGTCGATG
GCGATATCACCGAGGTGACTTTCGCGGAGACCGTACCCATGAGCACCTAT
CTGGCCGCCTTTGTGGTGTCTGATTTTCAATACAAGGAAACCACTGTGGA
GGGAACCAGCATCGCTCTGAAAGTCTATGCGCCACCAGCGCAGGTGGAGA
AAACCCAGTACGCCCTGGACACTGCGGCCGGAGTGATGGCCTACTACATC
AACTATTTCAATGTTTCGTATGCCCTACCCAAATTGGATCTGGTTGCCAT
ACCCGATTTCGTGTCCGGTGCTATGGAAAACTGGGGATTGGTCACGTTCC
GGGAGACGGCTCTTCTGTACGACGAATCTACCAGTTCCAGCGTGAATAAG
CAGCGTGTGGCCATCGTCGTGGCCCATGAGTTGGCTCACCAGTGGTTCGG
AAACCTGGTAACCATGAACTGGTGGAACGATTTGTGGCTAAACGAGGGTT
TCGCATCATTCCTTGAGTACAAGGGAGTAAAGCAAATGCATCCGGAATGG
GATATGGACAATCAGTTTGTTATTGAGGAACTGCACCCGGTGCTGACCAT
TGATGCCACCTTAGCCTCCCATCCGATTGTCAAGTCCATTGAGAGTCCAG
CCGAGATCACGGAGTACTTCGATACCATCACCTATTCAAAGGGAGCCGCC
TTAGTACGCATGCTTGAGAATCTGGTGGGCGAGGAAAAGTTGAGGAACGC
CACCACCCGCTATTTGGTGCGTCATATCTACAGTACTGCCACCACCGAGG
ATTACCTCACCGCAGTCGAGGAGGAGGAGGGCCTGGAATTTGACGTGAAG
CAGATCATGCAGACCTGGACGGAGCAGATGGGTCTTCCGGTTGTGGAGGT
GGAGAAAAGTGGCAGTACTTATAAGCTCACCCAAAAGCGTTTCCTGGCCA
ACGAAGATGACTACGCAGCCGAAGCTGAAGCATCGTCCTTCAACTACCGT
TGGTCGATTCCCATTACCTACACGAGCAGCATCAACAGTGAAGTCCAATC
ACTAATATTCAACCACAATGACAATGAGGCCACCATAACGCTTCCGGAAG
AGGCCAGCTGGATTAAGATTAACACGAATCAAGTGGGCTACTACCGGGTG
AACTACGGCAGCGAACAGTGGGCGGAACTCATATCGGCCCTGAAGAACTC
CCGGGAAACCTTCAGCACCGCCGATCGCGCTCATCTGCTGAACGATGCCA
ATACCCTGGCCGCTGCCGGACAGCTTAACTACTCCGTGGCACTGGATCTG
ATATCTTACCTGGAGAGCGAGCAGGACTACGTGCCCTGGAGCGTAGGCAC
CTCCGCCCTGGCTACGTTAAGGAACCGCGTATACTACACGGACTTGTACA
CTAATTACACCACCTACGCCCGTAAACTGCTTACGCCCATCGTAGAAAAG
GTCACGTTTACCGTGGCAGCCGATCATCTGGAAAATCGCCTCCGTATTAA
GGTGCTGAGCTCAGCCTGCAGCTTGGGACATGAGAGCTCCTTGCAACAGG
CGGTCACGCTCTTCAACCAGTGGCTAGCCAGCCCCGAGACCCGGCCCAAT
CCGGATATCCGAGACGTTGTCTACTACTATGGTCTGCAACAGGTGAACAC
AGAGGCTGCCTGGGATCAAGTTTGGAAGCTGTATCTGGACGAGAGTGATG
CCCAGGAAAAGCTGAAGTTGATGAACTGCCTAACCGCCGTGCAGGTGCCA
TGGCTGTTGCAGCGTTACATCAACTGGGCCTGGGATGAGAGCAATGTCCG
CCGCCAGGACTACTTCACCCTGCTTGGATATATATCCACCAATCCGGTGG
GTCAGAGTCTTGTGTGGGATTACGTGCGTGAAAACTGGGAGAAGTTGGTG
GATCGTTTCGGCATCAATGAACGCACCTTGGGTCGTCTGATCCCCACGAT
CACTGCCCGCTTCTCAACAGAAACCAAGCTGGAAGAGATGCAGCAGTTCT
TTGCCAAATATCCCGAGGCTGGAGCCGGAACTGCGGCCCGTCAACAGGCG
TTGGAAGCGGTGAAGGCAAACATCAAATGGCTAGCGGCCAACAAGGCCCA
GGTGGGCGAATGGTTGGCCAATTACGTTCAACAGTCCAGCGTCACCAACC
GCATTCAGTGAGCCCTAAACTCGGCCATTTGCACCTTGTAAAATATCAGT
AATGTAAAAACTACCAATGGAAGTGACTATAGTCTTAGCTAATTAGTGAA
GCAAAAGCATTTCAAATGTAAACGAAGAATTGTGATTGCTTATGATATTT
TTGAAGAAAATACAAGTGAAAAAAAAAAAAAAAA

FI04417.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-RA 3292 CG32473-RA 23..3292 1..3270 16350 100 Plus
CG32473-RC 3731 CG32473-RC 1296..3731 835..3270 12180 100 Plus
CG32473.a 3722 CG32473.a 1287..3722 835..3270 12180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9135277..9136242 835..1800 4635 98.7 Plus
chr3R 27901430 chr3R 9137086..9137918 2436..3268 4135 99.8 Plus
chr3R 27901430 chr3R 9136537..9137028 1944..2435 2445 99.8 Plus
chr3R 27901430 chr3R 9127962..9128344 83..465 1915 100 Plus
chr3R 27901430 chr3R 9129288..9129660 464..836 1865 100 Plus
chr3R 27901430 chr3R 9136307..9136450 1800..1943 690 98.6 Plus
chr3R 27901430 chr3R 9138474..9138706 1433..1676 595 84.8 Plus
chr3R 27901430 chr3R 9138852..9139115 1944..2225 545 81.2 Plus
chr3R 27901430 chr3R 9127817..9127899 1..83 415 100 Plus
chr3R 27901430 chr3R 25069963..25070071 1454..1346 335 87.2 Minus
chr3R 27901430 chr3R 9125511..9125595 1370..1454 290 89.4 Plus
chr3R 27901430 chr3R 9123006..9123241 2755..2990 280 74.6 Plus
chr3R 27901430 chr3R 9138706..9138780 1713..1787 270 90.7 Plus
chr3R 27901430 chr3R 9121083..9121263 1228..1408 245 75.7 Plus
chr3R 27901430 chr3R 24966342..24966442 1348..1448 220 81.2 Plus
chr3R 27901430 chr3R 25065409..25065488 1454..1375 220 85 Minus
chr3R 27901430 chr3R 25059694..25059773 1448..1369 205 83.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-RA 3039 CG32473-PA 1..3039 73..3111 15195 100 Plus
CG32473-RB 2712 CG32473-PB 436..2712 835..3111 11385 100 Plus
CG32473-RC 3078 CG32473-PC 802..3078 835..3111 11385 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:27 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-RA 3273 CG32473-RA 6..3273 1..3268 16340 100 Plus
CG32473-RB 3002 CG32473-RB 569..3002 835..3268 12170 100 Plus
CG32473-RC 3635 CG32473-RC 1202..3635 835..3268 12170 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-PA 1012 CG32473-PA 1..1012 73..3108 4775 100 Plus
CG32473-PB 903 CG32473-PB 16..903 460..3108 3889 88.7 Plus
CG32473-PC 1025 CG32473-PC 138..1025 460..3108 3889 88.7 Plus
CG8773-PB 994 CG8773-PB 110..989 439..3066 2544 56.5 Plus
CG8774-PB 885 CG8774-PB 8..885 469..3105 2192 49 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13310144..13311109 835..1800 4830 100 Plus
3R 32079331 3R 13311953..13312791 2436..3274 4195 100 Plus
3R 32079331 3R 13311404..13311895 1944..2435 2460 100 Plus
3R 32079331 3R 13302798..13303180 83..465 1915 100 Plus
3R 32079331 3R 13304124..13304496 464..836 1865 100 Plus
3R 32079331 3R 13311174..13311317 1800..1943 720 100 Plus
3R 32079331 3R 13313341..13313573 1433..1676 595 84.8 Plus
3R 32079331 3R 13313710..13313973 1944..2225 545 81.2 Plus
3R 32079331 3R 13302653..13302735 1..83 415 100 Plus
3R 32079331 3R 29247180..29247288 1454..1346 320 86.2 Minus
3R 32079331 3R 13300347..13300431 1370..1454 305 90.6 Plus
3R 32079331 3R 13297841..13298076 2755..2990 280 74.6 Plus
3R 32079331 3R 13295918..13296098 1228..1408 245 75.7 Plus
3R 32079331 3R 29242633..29242712 1454..1375 220 85 Minus
3R 32079331 3R 29236928..29237007 1448..1369 205 83.8 Minus
3R 32079331 3R 29143469..29143569 1348..1448 190 79.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:27:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13050975..13051940 835..1800 4830 100 Plus
3R 31820162 3R 13052784..13053622 2436..3274 4195 100 Plus
3R 31820162 3R 13052235..13052726 1944..2435 2460 100 Plus
3R 31820162 3R 13043629..13044011 83..465 1915 100 Plus
3R 31820162 3R 13044955..13045327 464..836 1865 100 Plus
3R 31820162 3R 13052005..13052148 1800..1943 720 100 Plus
3R 31820162 3R 13054172..13054366 1433..1632 585 87 Plus
3R 31820162 3R 13054541..13054722 1944..2128 525 86.4 Plus
3R 31820162 3R 13043484..13043566 1..83 415 100 Plus
3R 31820162 3R 28988011..28988119 1454..1346 320 86.2 Minus
3R 31820162 3R 13041178..13041262 1370..1454 305 90.5 Plus
3R 31820162 3R 13038804..13038907 2887..2990 265 83.6 Plus
3R 31820162 3R 13036749..13036929 1228..1408 245 75.6 Plus
3R 31820162 3R 13054728..13054804 2149..2225 235 87 Plus
3R 31820162 3R 28983464..28983543 1454..1375 220 85 Minus
3R 31820162 3R 28977759..28977838 1448..1369 205 83.7 Minus
3R 31820162 3R 28884300..28884400 1348..1448 190 79.2 Plus
3R 31820162 3R 13037000..13037062 1408..1470 180 85.7 Plus
3R 31820162 3R 13054906..13054955 3225..3273 165 92 Plus
3R 31820162 3R 13041037..13041130 1229..1322 140 76.5 Plus
3R 31820162 3R 28883758..28883818 854..914 140 81.9 Plus
Blast to na_te.dros performed on 2014-11-26 20:04:20 has no hits.

FI04417.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:20:52 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9137086..9137918 2436..3268 99   Plus
chr3R 9136537..9137028 1944..2435 99 -> Plus
chr3R 9136307..9136450 1800..1943 98 -> Plus
chr3R 9135279..9136241 837..1799 98 -> Plus
chr3R 9129290..9129660 466..836 100 -> Plus
chr3R 9128158..9128344 279..465 100 -> Plus
chr3R 9127962..9128106 83..227 100 == Plus
chr3R 9127817..9127898 1..82 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:41:32 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 1..3039 73..3111 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:13:08 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 1..3039 73..3111 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:56:16 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 1..3039 73..3111 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:20:52 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 1..3039 73..3111 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:41:31 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 1..3268 1..3268 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:13:07 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 1..3268 1..3268 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:56:16 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 6..3273 1..3268 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-19 19:29:30 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 1..3268 1..3268 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:20:52 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RA 6..3273 1..3268 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:20:52 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13311953..13312785 2436..3268 100   Plus
3R 13311404..13311895 1944..2435 100 -> Plus
3R 13311174..13311317 1800..1943 100 -> Plus
3R 13310146..13311108 837..1799 100 -> Plus
3R 13304126..13304496 466..836 100 -> Plus
3R 13302798..13303180 83..465 100 -> Plus
3R 13302653..13302734 1..82 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:56:16 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9137675..9138507 2436..3268 100   Plus
arm_3R 9137126..9137617 1944..2435 100 -> Plus
arm_3R 9136896..9137039 1800..1943 100 -> Plus
arm_3R 9135868..9136830 837..1799 100 -> Plus
arm_3R 9129848..9130218 466..836 100 -> Plus
arm_3R 9128520..9128902 83..465 100 -> Plus
arm_3R 9128375..9128456 1..82 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:43:42 Download gff for FI04417.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13052784..13053616 2436..3268 100   Plus
3R 13052235..13052726 1944..2435 100 -> Plus
3R 13052005..13052148 1800..1943 100 -> Plus
3R 13050977..13051939 837..1799 100 -> Plus
3R 13044957..13045327 466..836 100 -> Plus
3R 13043629..13044011 83..465 100 -> Plus
3R 13043484..13043565 1..82 100 -> Plus

FI04417.pep Sequence

Translation from 0 to 3110

> FI04417.pep
SFQFGFQPSGSSRVIFIEKRISLKMVAWLTVKSVAIFLGLASTAFCVATI
VLAVQNADLENDLQDALDKIDALTVDTTSTSSTSTSTSTTTTTANPNGPT
DDTEPGSTTTPGVGGDTTPSAGTSPGGETSPSSSTGSTTNPIYPTLPTGL
PDPEKIEWRLPTELTPIKYKVYYHPDLTTGACEGTVSIQFQLNAITNLIV
LHAKELNVHSISILNMMARIRVAIDSINLDESRELLLITLREVLSMNKAY
TLSASFDCDLSSLVGSYISNYTNADGVDRSIISTKFEPTYARQAFPCFDE
PALKAQFTITVARPSGDEYHVLSNMPVASEYVDGDITEVTFAETVPMSTY
LAAFVVSDFQYKETTVEGTSIALKVYAPPAQVEKTQYALDTAAGVMAYYI
NYFNVSYALPKLDLVAIPDFVSGAMENWGLVTFRETALLYDESTSSSVNK
QRVAIVVAHELAHQWFGNLVTMNWWNDLWLNEGFASFLEYKGVKQMHPEW
DMDNQFVIEELHPVLTIDATLASHPIVKSIESPAEITEYFDTITYSKGAA
LVRMLENLVGEEKLRNATTRYLVRHIYSTATTEDYLTAVEEEEGLEFDVK
QIMQTWTEQMGLPVVEVEKSGSTYKLTQKRFLANEDDYAAEAEASSFNYR
WSIPITYTSSINSEVQSLIFNHNDNEATITLPEEASWIKINTNQVGYYRV
NYGSEQWAELISALKNSRETFSTADRAHLLNDANTLAAAGQLNYSVALDL
ISYLESEQDYVPWSVGTSALATLRNRVYYTDLYTNYTTYARKLLTPIVEK
VTFTVAADHLENRLRIKVLSSACSLGHESSLQQAVTLFNQWLASPETRPN
PDIRDVVYYYGLQQVNTEAAWDQVWKLYLDESDAQEKLKLMNCLTAVQVP
WLLQRYINWAWDESNVRRQDYFTLLGYISTNPVGQSLVWDYVRENWEKLV
DRFGINERTLGRLIPTITARFSTETKLEEMQQFFAKYPEAGAGTAARQQA
LEAVKANIKWLAANKAQVGEWLANYVQQSSVTNRIQ*

FI04417.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17593-PA 1027 GF17593-PA 140..1027 154..1036 3598 75.5 Plus
Dana\GF17590-PA 974 GF17590-PA 3..969 29..1022 2649 52.5 Plus
Dana\GF17591-PA 938 GF17591-PA 63..934 154..1022 2194 49 Plus
Dana\GF23291-PA 991 GF23291-PA 105..987 159..1024 1286 33.3 Plus
Dana\GF22895-PA 926 GF22895-PA 27..920 158..1020 1209 33.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19578-PA 1025 GG19578-PA 1..1025 25..1036 4925 92.3 Plus
Dere\GG19555-PA 1001 GG19555-PA 3..996 29..1022 2804 54.6 Plus
Dere\GG19567-PA 942 GG19567-PA 62..931 154..1024 2227 48.4 Plus
Dere\GG11647-PA 999 GG11647-PA 113..998 159..1027 1317 33.9 Plus
Dere\GG14795-PA 1075 GG14795-PA 218..1073 159..1024 1234 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18430-PA 1011 GH18430-PA 1..1010 25..1035 3921 73.1 Plus
Dgri\GH18428-PA 957 GH18428-PA 3..957 29..1030 2600 50.4 Plus
Dgri\GH18429-PA 1989 GH18429-PA 1224..1977 275..1023 2122 52.6 Plus
Dgri\GH18429-PA 1989 GH18429-PA 36..694 154..814 1692 48.9 Plus
Dgri\GH18429-PA 1989 GH18429-PA 688..1230 275..814 1498 52.1 Plus
Dgri\GH17454-PA 1006 GH17454-PA 111..994 159..1022 1258 33.7 Plus
Dgri\GH16241-PA 1007 GH16241-PA 149..1002 159..1022 1222 33 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-PA 1012 CG32473-PA 1..1012 25..1036 5227 100 Plus
CG32473-PC 1025 CG32473-PC 115..1025 131..1036 4023 86.9 Plus
CG32473-PB 903 CG32473-PB 16..903 154..1036 4014 88.7 Plus
CG8773-PB 994 CG8773-PB 3..989 29..1022 2805 55.1 Plus
CG8774-PB 885 CG8774-PB 8..885 157..1035 2238 49 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24331-PA 1016 GI24331-PA 1..1015 25..1035 3960 73.5 Plus
Dmoj\GI24329-PA 959 GI24329-PA 3..952 29..1022 2647 52.2 Plus
Dmoj\GI24330-PA 940 GI24330-PA 55..928 154..1023 2274 50.1 Plus
Dmoj\GI22778-PA 1004 GI22778-PA 113..999 159..1026 1231 31.9 Plus
Dmoj\GI22347-PA 930 GI22347-PA 18..917 150..1018 1204 33 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24466-PA 1025 GL24466-PA 1..1024 25..1035 4365 79.7 Plus
Dper\GL24464-PA 976 GL24464-PA 3..973 29..1024 2719 53.4 Plus
Dper\GL24465-PA 945 GL24465-PA 63..945 154..1035 2243 48.5 Plus
Dper\GL23913-PA 983 GL23913-PA 105..983 159..1029 1300 34.2 Plus
Dper\GL22605-PA 1001 GL22605-PA 139..998 154..1022 1262 33.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16930-PD 1015 GA16930-PD 1..1014 25..1035 4330 80.9 Plus
Dpse\GA16930-PB 1026 GA16930-PB 115..1025 131..1035 3629 75.7 Plus
Dpse\GA16930-PC 904 GA16930-PC 16..903 154..1035 3618 77.2 Plus
Dpse\GA21310-PA 982 GA21310-PA 3..979 29..1024 2675 53.1 Plus
Dpse\GA21311-PA 945 GA21311-PA 63..933 154..1023 2236 48.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24100-PA 565 GM24100-PA 1..565 472..1036 2992 98.6 Plus
Dsec\GM24097-PA 1002 GM24097-PA 3..997 29..1022 2739 53.9 Plus
Dsec\GM24098-PA 942 GM24098-PA 56..931 148..1024 2257 48.7 Plus
Dsec\GM24099-PA 437 GM24099-PA 1..436 25..458 1978 94 Plus
Dsec\GM12769-PA 999 GM12769-PA 113..998 159..1027 1295 33.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18897-PA 790 GD18897-PA 1..789 25..811 3892 96.5 Plus
Dsim\GD18895-PA 966 GD18895-PA 3..961 29..1022 2640 52.8 Plus
Dsim\GD18896-PA 942 GD18896-PA 56..931 148..1024 2257 48.8 Plus
Dsim\GD13621-PA 1075 GD13621-PA 218..1073 159..1024 1230 33.4 Plus
Dsim\GD17862-PA 927 GD17862-PA 22..918 153..1017 1204 33 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10417-PA 1017 GJ10417-PA 1..1016 25..1035 4083 75.1 Plus
Dvir\GJ10415-PA 956 GJ10415-PA 3..948 29..1022 2617 51.6 Plus
Dvir\GJ10416-PA 954 GJ10416-PA 69..942 154..1023 2346 50.7 Plus
Dvir\GJ12921-PA 1008 GJ12921-PA 152..1005 159..1022 1249 33.4 Plus
Dvir\GJ22781-PA 1004 GJ22781-PA 113..995 159..1022 1249 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13936-PA 1009 GK13936-PA 1..1009 25..1036 4116 75.4 Plus
Dwil\GK13934-PA 970 GK13934-PA 3..970 29..971 2471 50.8 Plus
Dwil\GK13935-PA 945 GK13935-PA 66..940 154..1023 2224 48.9 Plus
Dwil\GK11892-PA 1015 GK11892-PA 128..1012 159..1026 1287 32.9 Plus
Dwil\GK16986-PA 1007 GK16986-PA 151..1004 159..1022 1228 33.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26262-PA 1025 GE26262-PA 115..1025 131..1036 4075 84.7 Plus
Dyak\GE26259-PA 977 GE26259-PA 3..972 29..1022 2764 54.5 Plus
Dyak\GE26260-PA 942 GE26260-PA 56..929 148..1022 2264 49 Plus
Dyak\GE23837-PA 999 GE23837-PA 113..998 159..1027 1310 34 Plus
Dyak\GE21157-PA 1075 GE21157-PA 218..1073 159..1024 1230 33.3 Plus

FI04417.hyp Sequence

Translation from 0 to 3110

> FI04417.hyp
SFQFGFQPSGSSRVIFIEKRISLKMVAWLTVKSVAIFLGLASTAFCVATI
VLAVQNADLENDLQDALDKIDALTVDTTSTSSTSTSTSTTTTTANPNGPT
DDTEPGSTTTPGVGGDTTPSAGTSPGGETSPSSSTGSTTNPIYPTLPTGL
PDPEKIEWRLPTELTPIKYKVYYHPDLTTGACEGTVSIQFQLNAITNLIV
LHAKELNVHSISILNMMARIRVAIDSINLDESRELLLITLREVLSMNKAY
TLSASFDCDLSSLVGSYISNYTNADGVDRSIISTKFEPTYARQAFPCFDE
PALKAQFTITVARPSGDEYHVLSNMPVASEYVDGDITEVTFAETVPMSTY
LAAFVVSDFQYKETTVEGTSIALKVYAPPAQVEKTQYALDTAAGVMAYYI
NYFNVSYALPKLDLVAIPDFVSGAMENWGLVTFRETALLYDESTSSSVNK
QRVAIVVAHELAHQWFGNLVTMNWWNDLWLNEGFASFLEYKGVKQMHPEW
DMDNQFVIEELHPVLTIDATLASHPIVKSIESPAEITEYFDTITYSKGAA
LVRMLENLVGEEKLRNATTRYLVRHIYSTATTEDYLTAVEEEEGLEFDVK
QIMQTWTEQMGLPVVEVEKSGSTYKLTQKRFLANEDDYAAEAEASSFNYR
WSIPITYTSSINSEVQSLIFNHNDNEATITLPEEASWIKINTNQVGYYRV
NYGSEQWAELISALKNSRETFSTADRAHLLNDANTLAAAGQLNYSVALDL
ISYLESEQDYVPWSVGTSALATLRNRVYYTDLYTNYTTYARKLLTPIVEK
VTFTVAADHLENRLRIKVLSSACSLGHESSLQQAVTLFNQWLASPETRPN
PDIRDVVYYYGLQQVNTEAAWDQVWKLYLDESDAQEKLKLMNCLTAVQVP
WLLQRYINWAWDESNVRRQDYFTLLGYISTNPVGQSLVWDYVRENWEKLV
DRFGINERTLGRLIPTITARFSTETKLEEMQQFFAKYPEAGAGTAARQQA
LEAVKANIKWLAANKAQVGEWLANYVQQSSVTNRIQ*

FI04417.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-PA 1012 CG32473-PA 1..1012 25..1036 5227 100 Plus
CG32473-PC 1025 CG32473-PC 115..1025 131..1036 4023 86.9 Plus
CG32473-PB 903 CG32473-PB 16..903 154..1036 4014 88.7 Plus
CG8773-PB 994 CG8773-PB 3..989 29..1022 2805 55.1 Plus
CG8774-PB 885 CG8774-PB 8..885 157..1035 2238 49 Plus