Clone FI04418 Report

Search the DGRC for FI04418

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:18
Vector:pFlc-1
Associated Gene/TranscriptSAK-RA
Protein status:FI04418.pep: gold
Sequenced Size:3384

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
SAK 2008-12-18 5.12 accounting

Clone Sequence Records

FI04418.complete Sequence

3384 bp assembled on 2008-09-23

GenBank Submission: BT044561.1

> FI04418.complete
ATTAAAATTTCCCAACACTAACGGTGGCGTTTAAATTTTGTTCGGCTTGT
TTGTTTATATGGCTTTAGTTTTTTGATAAATAACAACAAGACATTCCGAG
TGGCTCAGTAAGTCTACAGAAAAAAGGCTAGCTATGTTATCCAATCGGGC
GTTTGGAGAAACAATTGAGGACTATGAAGTACAGCACTTGCTGGGTAAAG
GTGGTTTTGCGACCGTCTACAAGGCGCGGTGCCTGCACACTCACCAGGAT
GTGGCCATAAAGATGATCGATAAAAAACTAATCCAGGGCACTGGACTCAC
TAACCGCGTTCGCCAGGAAGTGGAAATCCACTCCCGCCTGAAGCATCCCT
CTGTGCTTCAGCTGTACACTTTCTTTCAGGACGCCAACTATGTGTATTTG
GTGCTCGAGCTGGCCCATAATGGGGAGCTTCATCGCTATATGAACCACAT
CGCCAGACCCTTCACAGAGACGGAAGCTGCTTCCATTCTGAAGCAGGTGG
TGGCGGGACTTTTGTACCTGCACTCCCACAACATCATGCACCGCGACATT
TCGCTGTCCAACCTACTGCTTAGCAGGGAAATGCACGTCAAGATAGCCGA
TTTTGGACTGGCCACCCAATTAAAGCGACCTGATGAGCGCCATATGACCA
TGTGTGGAACTCCGAACTATATTTCGCCTGAGGTGGTATCGCGAACGTCT
CACGGACTGCCCGCGGACGTCTGGAGCGTTGGATGCATGCTGTACACCCT
GCTGGTTGGACGCCCGCCCTTCGAAACCGATGCAGTGCAGTCAACCCTTA
ACAAAGTTGTGATGTCCGAGTACATTATGCCGGCTCACTTGTCTTACGAG
GCGCAGGACCTGATAAACAAATTATTAAAAAAGCTCCCGCACGAACGAAT
TACCCTGGAGGCTGTTCTCTGCCATCCCTTTATGTTGAAATGCTCAAATG
GTGGACACTCTGCGCCGGGAGCGTTGAATGTGTTCAGCCAGAGTATGGAA
AGTGGCGATAGTGGAATCATAACATTTGCTAGCAGTGACTCCCGGAATTC
CCAGCAAATTCGATCTGTGGAAAACTCAGGACCACAACAAGTGCTTCCTC
AAATACGGGAGGAATTTAAGCAAGTCCATCATAAATTGCCTTATGAACAG
ACAGGTTTATTTGGGCAAGCTTCAACTGGCTTGGCAGAGCCAAATTGGCC
AGGAGCTGCTAAGTCCTCAGCGTTCTGCATGGAGGCGGGCAATGTACCCA
ATTCCAAACAGGCATCTCTTAAGGAAGATCGCATTTCGGTGCCACCATTG
AATACTAAAAGACTGCTTCCGACGCGTTATAAGACGAAGAATGCTATAAT
GAGTATTTTGCGCAATGGAGAGGTAGTTCTCGAGTTTCTTAAGTTTCGGC
CAACCTATAATGAAGATCGCATTAATGATATTTGTCGCATATCGGATGAC
GGACAGCGAATCATAATTTATCAACCAGATCCTGGGCGTGGCTTACCAGT
GAGAGAGCAGCCACCAGATCTTCAAATACCAAGCGGAGATTGTGTATATA
ACTACGATAATTTGCCCAGCAAGCACTGGAAAAAATACATATACGGAGCT
CGATTTGTAGGGCTGGTAAAAAGCAAAACACCAAAAGTCACATACTTCAG
TACTCTAGGCAAATGCCAATTGATGGAGACAATGACCGACTTTGAGATTC
GTTTCTACTCGGGAGCTAAGCTACTAAAGACGCCGTCCGAGGGGCTAAAG
GTCTACGATCGAAATGGAATGTTGCTCTCGGATTATTCCTGTTCGGAGTC
ACGATCCCTAATAGAGCACGGAAACGAGTGTTTCACCCACTGTGTCAACA
TCAGTAATGCCTTGGAAGTAGCTCAGACGAAAGATAATTCGTGTTTTCCA
GTCACAATCGGACGAAGACCTATAACAGATGTACAACCCGCTCAGAGATT
GGATGGCCTACGAGATACCACCAATATTGCGTTTTCCACACCAAAATCTA
ATCAGGGCTCAATAAACTTTTCCTTAAGCACTATTTCGTCGACTCGAAAT
ACTTCAGATTTTGGAACCAACTGCTCTAGGTCCAACATGCTAGCCGCCCA
TCAAAATATACCCATCAAACGCATAAACGTTCCTGAAATCGGAATAGCTA
CTGAGCTCTCCCATGGAGTTGTCCAAGTGCAATTTTATGATGGATCCGTG
GTCTCTGTTATTCCGAGCATGCAAGGTGGTGGTATAACCTATACCCAACC
CAACGGAACTTCAACCCACTTCGGCAAGGGCGACGACTTGCCATTCCCGG
TCAGAGATAGAGTCGGTCAGATACCAAACATTCAGTTAAAGTTGAAGACA
GCTCCATTGCTGGGAAGCGGCAGGAAAACTGACTACAACAATGCAATGAC
TCCCAAAACGACAACGCCTTATTATAATCGCATGCTTCTTTAATTGAATC
AAAACTTAATTCCAAAATAGTTTTTTAAGTTTGAACAAATGTACTTGTAT
TGTAAATTAAGGGTAAATATATTTTTTACGTTTTCCCCGTGCTTATCAAA
ATAATTGACACAAAAATTATTCAATGTAACTATGCTTTCTTTTGTAAGTT
TTAAAAGAGTATAAAGGAAGAAAACAAAAACTGATTGGTTTCTTTGTATT
TGTAATTCAATAATTTGCGAATCCTTGTCCATTTGCAAGTAAAATTAATG
AGTATGGGCCTACGTTCAAATTTCAATTCCAGTTTCGAACACACACAGCT
ATGATATTTGCTTTACCTCAAGTTCTTTATTTGATTTTCAAAAGTTTATA
CTTTTTGTATAAGTGTGAGGTTAGAAAATTTTAGTATAAAATATATTATT
GTTACGTACGTTTATATATTAAATACGAGATAAATAAATTTATACTTTTA
TACTTAGTAAAATCTTTAGACTAACATTGCCTTACTAAACTGATGCTACC
GCATTTACAAATTACTACGGCAGGATTCGTATTGCTTCAAAGTTGTAGAT
GCAATAGTGAAATATACACATTAAAAGTAATTTCTTGTACAGATTTTAAA
GACAATCATGCACGGATGGATTACACTATGTAATAATAATAAGTGGCGAT
TAACTATCCGTATATTAATAAAATGCATTCGGCAATTCAGAAGAATCAAT
TTGAGCATAAGCACCTGACTATTGTGTTGGCATGGATTTATTGATTGCAA
TGTAATAAAAAACGCAAAAATAATAAATGTAAACTAACTTAAGTCAATGG
ACGGAAGAAAAAAGTCAGTGGAACAGTACAGTAGATAAGAAGCATAATTT
CAGTGTAACATTTGATTTGGCAGTTTAAACATGGTGCAACTGCTCAACTA
ATAAAACGATAAACAGGCAAAAAAAAAAAAAAAA

FI04418.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
SAK-RA 3421 SAK-RA 41..3411 1..3371 16825 99.9 Plus
SAK.a 3337 SAK.a 34..3335 65..3366 16480 99.9 Plus
SAK.b 3324 SAK.b 126..3322 170..3366 15985 100 Plus
SAK.b 3324 SAK.b 19..126 1..108 525 99 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21501078..21502290 3366..2154 6065 100 Minus
chr3L 24539361 chr3L 21503672..21504443 1036..265 3860 100 Minus
chr3L 24539361 chr3L 21502577..21503095 2006..1488 2595 100 Minus
chr3L 24539361 chr3L 21503155..21503608 1488..1035 2270 100 Minus
chr3L 24539361 chr3L 21504650..21504819 170..1 835 99.4 Minus
chr3L 24539361 chr3L 21502371..21502523 2155..2003 765 100 Minus
chr3L 24539361 chr3L 21504496..21504593 265..168 490 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
SAK-RA 2310 CG7186-PA 1..2310 134..2443 11550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:28 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
SAK-RA 3371 CG7186-RA 4..3369 1..3366 16815 100 Plus
M6-RF 2370 CG7540-RF 1764..2370 3366..2760 3035 100 Minus
M6-RE 2157 CG7540-RE 1551..2157 3366..2760 3035 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
SAK-PA 769 CG7186-PA 1..769 134..2440 4029 100 Plus
polo-PB 576 CG12306-PB 25..277 173..934 522 38.9 Plus
polo-PA 576 CG12306-PA 25..277 173..934 522 38.9 Plus
aurA-PA 411 CG3068-PA 151..407 164..937 480 38.3 Plus
aurB-PA 329 CG6620-PA 34..302 128..925 473 38.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21512138..21513355 3371..2154 6075 99.9 Minus
3L 28110227 3L 21514737..21515508 1036..265 3860 100 Minus
3L 28110227 3L 21513642..21514160 2006..1488 2595 100 Minus
3L 28110227 3L 21514220..21514673 1488..1035 2270 100 Minus
3L 28110227 3L 21515715..21515884 170..1 835 99.4 Minus
3L 28110227 3L 21513436..21513588 2155..2003 765 100 Minus
3L 28110227 3L 21515561..21515658 265..168 490 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21505238..21506455 3371..2154 6075 99.9 Minus
3L 28103327 3L 21507837..21508608 1036..265 3860 100 Minus
3L 28103327 3L 21506742..21507260 2006..1488 2595 100 Minus
3L 28103327 3L 21507320..21507773 1488..1035 2270 100 Minus
3L 28103327 3L 21508815..21508984 170..1 835 99.4 Minus
3L 28103327 3L 21506536..21506688 2155..2003 765 100 Minus
3L 28103327 3L 21508661..21508758 265..168 490 100 Minus
Blast to na_te.dros performed 2014-11-27 03:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
transib3 2883 transib3 TRANSIB3 2883bp 2567..2689 2792..2912 150 62.4 Plus

FI04418.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:32:39 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21504651..21504819 1..169 99   Minus
chr3L 21504496..21504591 170..265 100 <- Minus
chr3L 21503674..21504442 266..1034 100 <- Minus
chr3L 21503155..21503608 1035..1488 100 <- Minus
chr3L 21502578..21503094 1489..2005 100 <- Minus
chr3L 21502371..21502520 2006..2155 100 <- Minus
chr3L 21501076..21502288 2156..3368 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:47:38 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 1..2310 134..2443 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:13:17 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 1..2310 134..2443 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:46 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 1..2310 134..2443 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:32:39 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 1..2310 134..2443 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:51:14 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 1..3368 1..3368 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:13:17 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 1..3368 1..3368 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:46 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 4..3371 1..3368 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 15:42:17 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 1..3368 1..3368 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:32:39 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
SAK-RA 4..3371 1..3368 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:32:39 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21515716..21515884 1..169 99   Minus
3L 21515561..21515656 170..265 100 <- Minus
3L 21514739..21515507 266..1034 100 <- Minus
3L 21514220..21514673 1035..1488 100 <- Minus
3L 21513643..21514159 1489..2005 100 <- Minus
3L 21513436..21513585 2006..2155 100 <- Minus
3L 21512141..21513353 2156..3368 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:46 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21508816..21508984 1..169 99   Minus
arm_3L 21508661..21508756 170..265 100 <- Minus
arm_3L 21507839..21508607 266..1034 100 <- Minus
arm_3L 21507320..21507773 1035..1488 100 <- Minus
arm_3L 21506743..21507259 1489..2005 100 <- Minus
arm_3L 21506536..21506685 2006..2155 100 <- Minus
arm_3L 21505241..21506453 2156..3368 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:43:53 Download gff for FI04418.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21508816..21508984 1..169 99   Minus
3L 21508661..21508756 170..265 100 <- Minus
3L 21507839..21508607 266..1034 100 <- Minus
3L 21507320..21507773 1035..1488 100 <- Minus
3L 21506743..21507259 1489..2005 100 <- Minus
3L 21506536..21506685 2006..2155 100 <- Minus
3L 21505241..21506453 2156..3368 99 <- Minus

FI04418.pep Sequence

Translation from 133 to 2442

> FI04418.pep
MLSNRAFGETIEDYEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLI
QGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELH
RYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSREM
HVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVG
CMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKK
LPHERITLEAVLCHPFMLKCSNGGHSAPGALNVFSQSMESGDSGIITFAS
SDSRNSQQIRSVENSGPQQVLPQIREEFKQVHHKLPYEQTGLFGQASTGL
AEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRISVPPLNTKRLLPTRYK
TKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDP
GRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTP
KVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLSD
YSCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRPITDV
QPAQRLDGLRDTTNIAFSTPKSNQGSINFSLSTISSTRNTSDFGTNCSRS
NMLAAHQNIPIKRINVPEIGIATELSHGVVQVQFYDGSVVSVIPSMQGGG
ITYTQPNGTSTHFGKGDDLPFPVRDRVGQIPNIQLKLKTAPLLGSGRKTD
YNNAMTPKTTTPYYNRMLL*

FI04418.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10707-PA 770 GF10707-PA 1..770 1..769 3443 82.3 Plus
Dana\GF10050-PA 575 GF10050-PA 25..277 14..267 527 38.9 Plus
Dana\GF17839-PA 404 GF17839-PA 144..400 11..268 492 38.3 Plus
Dana\GF14057-PA 329 GF14057-PA 36..305 1..267 481 38.2 Plus
Dana\GF21982-PA 1480 GF21982-PA 140..391 14..267 457 38 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13228-PA 766 GG13228-PA 1..766 1..769 3913 94.5 Plus
Dere\GG16099-PA 576 GG16099-PA 25..277 14..267 534 39.3 Plus
Dere\GG18531-PA 421 GG18531-PA 161..417 11..268 492 38.3 Plus
Dere\GG10347-PA 329 GG10347-PA 36..305 1..267 467 37.1 Plus
Dere\GG12656-PA 1421 GG12656-PA 146..397 14..267 452 37.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16744-PA 762 GH16744-PA 1..762 1..769 2680 66 Plus
Dgri\GH14380-PA 575 GH14380-PA 25..277 14..267 539 39.7 Plus
Dgri\GH23526-PA 398 GH23526-PA 137..393 10..267 473 36.8 Plus
Dgri\GH13588-PA 331 GH13588-PA 36..305 1..267 451 36 Plus
Dgri\GH24405-PA 1622 GH24405-PA 140..391 14..267 446 37.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
SAK-PA 769 CG7186-PA 1..769 1..769 4029 100 Plus
polo-PB 576 CG12306-PB 25..277 14..267 522 38.9 Plus
polo-PA 576 CG12306-PA 25..277 14..267 522 38.9 Plus
aurA-PA 411 CG3068-PA 151..407 11..268 480 38.3 Plus
aurB-PA 329 CG6620-PA 36..302 1..264 470 38.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13469-PA 778 GI13469-PA 1..778 1..769 2818 69 Plus
Dmoj\GI11323-PA 575 GI11323-PA 25..277 14..267 534 39.3 Plus
Dmoj\GI23550-PA 366 GI23550-PA 105..362 10..268 476 37.4 Plus
Dmoj\GI23549-PA 329 GI23549-PA 36..303 1..267 452 36.8 Plus
Dmoj\GI23560-PA 329 GI23560-PA 36..303 1..267 446 36 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:47:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11903-PA 777 GL11903-PA 1..777 1..769 3102 73.9 Plus
Dper\GL25129-PA 575 GL25129-PA 25..277 14..267 532 38.9 Plus
Dper\GL25881-PA 567 GL25881-PA 25..277 14..267 519 39.3 Plus
Dper\GL22255-PA 416 GL22255-PA 156..412 11..268 501 39.5 Plus
Dper\GL19028-PA 329 GL19028-PA 36..305 1..267 483 37.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20166-PA 777 GA20166-PA 1..777 1..769 3104 73.9 Plus
Dpse\GA11545-PB 575 GA11545-PB 25..277 14..267 532 38.9 Plus
Dpse\GA25172-PA 567 GA25172-PA 25..277 14..267 515 39.3 Plus
Dpse\GA15904-PA 416 GA15904-PA 156..412 11..268 502 39.5 Plus
Dpse\GA19730-PA 329 GA19730-PA 36..305 1..267 483 37.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22133-PA 769 GM22133-PA 1..769 1..769 4051 97.5 Plus
Dsec\GM22270-PA 576 GM22270-PA 25..277 14..267 529 38.9 Plus
Dsec\GM23989-PA 421 GM23989-PA 161..417 11..268 493 38.3 Plus
Dsec\GM11336-PA 329 GM11336-PA 36..305 1..267 474 37.8 Plus
Dsec\GM18924-PA 1329 GM18924-PA 145..396 14..267 451 37.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12112-PA 769 GD12112-PA 1..769 1..769 4082 98.3 Plus
Dsim\GD14871-PA 558 GD14871-PA 25..277 14..267 529 38.9 Plus
Dsim\GD18792-PA 421 GD18792-PA 161..417 11..268 493 38.3 Plus
Dsim\GD22216-PA 329 GD22216-PA 36..305 1..267 474 37.8 Plus
Dsim\GD20665-PA 603 GD20665-PA 63..329 14..286 437 35.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11832-PA 781 GJ11832-PA 1..781 1..769 2760 67.5 Plus
Dvir\GJ11579-PA 575 GJ11579-PA 25..277 14..267 536 39.3 Plus
Dvir\GJ23510-PA 363 GJ23510-PA 103..359 11..268 486 37.9 Plus
Dvir\GJ20756-PA 331 GJ20756-PA 36..305 1..267 479 36.8 Plus
Dvir\GJ16386-PA 1350 GJ16386-PA 120..371 14..267 447 37.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17621-PA 787 GK17621-PA 1..787 1..769 2785 67.7 Plus
Dwil\GK17233-PA 575 GK17233-PA 25..277 14..267 519 38.5 Plus
Dwil\GK13515-PA 406 GK13515-PA 146..402 11..268 497 39.1 Plus
Dwil\GK18371-PA 331 GK18371-PA 36..305 1..267 457 36.4 Plus
Dwil\GK25743-PA 1437 GK25743-PA 169..420 14..267 455 37.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22325-PA 766 GE22325-PA 1..766 1..769 3903 93.9 Plus
Dyak\GE19659-PA 651 GE19659-PA 108..352 22..267 519 39.4 Plus
Dyak\GE26150-PA 417 GE26150-PA 157..413 11..268 493 38.3 Plus
Dyak\GE13219-PA 329 GE13219-PA 36..305 1..267 471 37.5 Plus
Dyak\GE16985-PA 1400 GE16985-PA 144..395 14..267 453 37.6 Plus

FI04418.hyp Sequence

Translation from 133 to 2442

> FI04418.hyp
MLSNRAFGETIEDYEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLI
QGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELH
RYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSREM
HVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVG
CMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKK
LPHERITLEAVLCHPFMLKCSNGGHSAPGALNVFSQSMESGDSGIITFAS
SDSRNSQQIRSVENSGPQQVLPQIREEFKQVHHKLPYEQTGLFGQASTGL
AEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRISVPPLNTKRLLPTRYK
TKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICRISDDGQRIIIYQPDP
GRGLPVREQPPDLQIPSGDCVYNYDNLPSKHWKKYIYGARFVGLVKSKTP
KVTYFSTLGKCQLMETMTDFEIRFYSGAKLLKTPSEGLKVYDRNGMLLSD
YSCSESRSLIEHGNECFTHCVNISNALEVAQTKDNSCFPVTIGRRPITDV
QPAQRLDGLRDTTNIAFSTPKSNQGSINFSLSTISSTRNTSDFGTNCSRS
NMLAAHQNIPIKRINVPEIGIATELSHGVVQVQFYDGSVVSVIPSMQGGG
ITYTQPNGTSTHFGKGDDLPFPVRDRVGQIPNIQLKLKTAPLLGSGRKTD
YNNAMTPKTTTPYYNRMLL*

FI04418.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
SAK-PA 769 CG7186-PA 1..769 1..769 4029 100 Plus
polo-PB 576 CG12306-PB 25..277 14..267 522 38.9 Plus
polo-PA 576 CG12306-PA 25..277 14..267 522 38.9 Plus
aurA-PA 411 CG3068-PA 151..407 11..268 480 38.3 Plus
aurB-PA 329 CG6620-PA 36..302 1..264 470 38.2 Plus