Clone FI04419 Report

Search the DGRC for FI04419

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:19
Vector:pFlc-1
Associated Gene/TranscriptLamp1-RA
Protein status:FI04419.pep: gold
Sequenced Size:1599

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3305 2008-12-18 5.12 accounting

Clone Sequence Records

FI04419.complete Sequence

1599 bp assembled on 2008-11-06

GenBank Submission: BT050563.1

> FI04419.complete
TGAAAAATAAAAACTAGCTCAGTCGAGACAAAAACGTATGTGTCAGTGTA
GTAGATTAACGTATAGAAAAACTGCAACACAACTTAAGTGAGATTGCCAT
TCAATATGTTCGCCAACAAATTGTTGACCTGCTCGGCATTACTAATAATG
TTATTTTTACTAAGCAGTACAGTGTTCTCTCAAAAGCTTATTGGCTTGCC
GAGAGTCGGTAAAAATGTTAGTGATTTGTTTCTGGAACAAGCAAACCCAC
TGACCAGCAGCTCCTCAACAATCTCAACGTCTTCGACAACAACTGAGAAA
CCTATCACAACCAGATCAACTTCTACAATAACTCCGAGATCTACCACACC
TTCAACGGAATCACCATCGACCACCGCACCAGTGATAAGCACGACCATTG
CCCCGCAACCATATCCGCAACCATCCATTGGGGCTTGGAATACCTCTTGT
ATTATGCTTCAAATGGCGGCACAACTTAATTTTACCTATGAGGCTAGGGA
GGGAAACTTTACCACCGGTCTGTACAACATCCCCAGCAACGCATCTGTTG
AAGATGCAGAATGTAAAAGCCAGACTACTCAGTTTATTCATCTGATTTGG
GGACCAGAAACATCAAAGCAATCATTAATTATGTATTTTAATAAAAGTAA
TGACACCACTGTGCTTTCCTTTATGCAAATTCATCTGGCTTTGCTGCCTG
AGGATTTTCCAGATGCAAAGGAAAATCAAACGGTTCAGCTTATTACCAGG
AGCGACGGAGCGTTTAAGACACCAGAAAATATGTCGTATCACTGCACTCG
TGTTCAGAAGATAAATATGACTGAGACACTCGATGCTGAGCAGTTAATTG
GTTGGATCAGCGTCAGTCATGTTCAGGTGGAGGCTTTCCGGAGGGCCAAC
GACACTGGTTTCTCAGTTGGACACGATTGCGATAGCTCGGAAACTTCGGA
TGTGGTTCCCATTGCCGTTGGAATTGCTTTAGCTGCATTAATTTTGGTGG
TATTAATATCATATCTGTGTGCTAGGCGTCGTTCCACCTCCCGCGGTTAC
ATGAGCTTCTAATAGAAGGACATCAGCTTAATTGGGCAGGTTGCGAATCA
AAGGAGTATGGACAGCAAATTGTTAGAGAGAAATTTAAGATTGATTTTTA
TTATTGGAAGCCAAAATTGATTAGTTGAAGTTGAATTAGTTTTTTTTTTC
AAGAGGGTCATCGAAATCATCAAGCGCAATTGGGTTTAGAATAATAAAAC
GGTTCTTTAAAAACTTTTTTACGTCTCTGTCTTTGTAAGTGTCCGATATT
GGTTCTTGTATGCTGATATTTGTGTTTTATTTAATTGGTTTGAGCAATGT
AAATGTAAAATAAAAAAAAAATTTCTAAATAAATTAATCTCTATAATGTA
GCTACCGTGTTAACCCTAAAAAGGTGGTGTCAGAGAGGACATTTCTATTG
TTAAGGCAAAAACCTGTACGCAATACCAACAAGTATACATTCTATTCAAA
TGTTATATTTTTTAAACATTATTATTGGGGCATATAAATGTGTGTATTCC
TGACCTTAACTGTAATAAATAATATTTAAAACCAAAAAAAAAAAAAAAA

FI04419.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG3305-RA 1669 CG3305-RA 49..1629 4..1585 7870 99.9 Plus
CG3305.b 1625 CG3305.b 38..1616 4..1585 7815 99.8 Plus
CG3305.c 1490 CG3305.c 70..1481 173..1585 7025 99.9 Plus
CG3305.c 1490 CG3305.c 38..69 4..35 160 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 21574737..21575598 721..1583 4265 99.9 Plus
chr2L 23010047 chr2L 21573280..21573608 171..499 1645 100 Plus
chr2L 23010047 chr2L 21574459..21574681 499..721 1115 100 Plus
chr2L 23010047 chr2L 21571888..21572056 4..172 845 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
Lamp1-RA 957 CG3305-PA 1..957 106..1062 4785 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:29 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
Lamp1-RA 1583 CG3305-RA 5..1583 4..1583 7850 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
Lamp1-PA 318 CG3305-PA 1..318 106..1059 1278 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21576242..21577105 721..1585 4275 99.9 Plus
2L 23513712 2L 21574785..21575113 171..499 1645 100 Plus
2L 23513712 2L 21575964..21576186 499..721 1115 100 Plus
2L 23513712 2L 21573393..21573561 4..172 845 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21576242..21577105 721..1585 4285 99.8 Plus
2L 23513712 2L 21574785..21575113 171..499 1645 100 Plus
2L 23513712 2L 21575964..21576186 499..721 1115 100 Plus
2L 23513712 2L 21573393..21573561 4..172 845 100 Plus
Blast to na_te.dros performed on 2014-11-27 11:49:42 has no hits.

FI04419.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:56:23 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21574738..21575598 722..1583 96   Plus
chr2L 21574460..21574681 500..721 100 -> Plus
chr2L 21573282..21573608 173..499 100 -> Plus
chr2L 21571886..21572056 1..172 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:47:41 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
CG3305-RA 1..957 106..1062 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:19:34 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
CG3305-RA 1..957 106..1062 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:14 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
Lamp1-RA 1..957 106..1062 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:56:23 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
Lamp1-RA 1..957 106..1062 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:00:25 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
CG3305-RA 14..1594 1..1583 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:19:34 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
CG3305-RA 14..1594 1..1583 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:14 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
Lamp1-RA 3..1583 1..1583 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-06 19:14:10 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
CG3305-RA 14..1594 1..1583 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:56:23 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
Lamp1-RA 3..1583 1..1583 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:56:23 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21576243..21577103 722..1583 99   Plus
2L 21575965..21576186 500..721 100 -> Plus
2L 21574787..21575113 173..499 100 -> Plus
2L 21573391..21573561 1..172 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:14 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21576243..21577103 722..1583 99   Plus
arm_2L 21575965..21576186 500..721 100 -> Plus
arm_2L 21574787..21575113 173..499 100 -> Plus
arm_2L 21573391..21573561 1..172 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:50:55 Download gff for FI04419.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21576243..21577103 722..1583 99   Plus
2L 21575965..21576186 500..721 100 -> Plus
2L 21574787..21575113 173..499 100 -> Plus
2L 21573391..21573561 1..172 98 -> Plus

FI04419.pep Sequence

Translation from 105 to 1061

> FI04419.pep
MFANKLLTCSALLIMLFLLSSTVFSQKLIGLPRVGKNVSDLFLEQANPLT
SSSSTISTSSTTTEKPITTRSTSTITPRSTTPSTESPSTTAPVISTTIAP
QPYPQPSIGAWNTSCIMLQMAAQLNFTYEAREGNFTTGLYNIPSNASVED
AECKSQTTQFIHLIWGPETSKQSLIMYFNKSNDTTVLSFMQIHLALLPED
FPDAKENQTVQLITRSDGAFKTPENMSYHCTRVQKINMTETLDAEQLIGW
ISVSHVQVEAFRRANDTGFSVGHDCDSSETSDVVPIAVGIALAALILVVL
ISYLCARRRSTSRGYMSF*

FI04419.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15483-PA 317 GF15483-PA 1..317 1..318 817 54.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21336-PA 317 GG21336-PA 1..317 1..318 1238 80.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13233-PA 325 GH13233-PA 106..325 100..318 758 63.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:21:46
Subject Length Description Subject Range Query Range Score Percent Strand
Lamp1-PA 318 CG3305-PA 1..318 1..318 1616 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12441-PA 300 GI12441-PA 66..300 82..318 831 66 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26666-PA 332 GL26666-PA 113..332 99..318 843 68.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17249-PA 332 GA17249-PA 113..332 99..318 846 69.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16136-PA 390 GM16136-PA 201..390 129..318 940 90 Plus
Dsec\GM16136-PA 390 GM16136-PA 1..219 1..227 715 78.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24324-PA 316 GD24324-PA 1..316 1..318 1307 88.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17883-PA 324 GJ17883-PA 88..324 85..318 838 67.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18743-PA 325 GK18743-PA 1..325 1..318 753 54.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12921-PA 315 GE12921-PA 1..315 1..318 1199 78.7 Plus

FI04419.hyp Sequence

Translation from 105 to 1061

> FI04419.hyp
MFANKLLTCSALLIMLFLLSSTVFSQKLIGLPRVGKNVSDLFLEQANPLT
SSSSTISTSSTTTEKPITTRSTSTITPRSTTPSTESPSTTAPVISTTIAP
QPYPQPSIGAWNTSCIMLQMAAQLNFTYEAREGNFTTGLYNIPSNASVED
AECKSQTTQFIHLIWGPETSKQSLIMYFNKSNDTTVLSFMQIHLALLPED
FPDAKENQTVQLITRSDGAFKTPENMSYHCTRVQKINMTETLDAEQLIGW
ISVSHVQVEAFRRANDTGFSVGHDCDSSETSDVVPIAVGIALAALILVVL
ISYLCARRRSTSRGYMSF*

FI04419.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
Lamp1-PA 318 CG3305-PA 1..318 1..318 1616 100 Plus