Clone FI04427 Report

Search the DGRC for FI04427

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:27
Vector:pFlc-1
Associated Gene/TranscriptIswi-RA
Protein status:FI04427.pep: gold
Sequenced Size:3554

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Iswi 2008-12-18 5.12 accounting

Clone Sequence Records

FI04427.complete Sequence

3554 bp assembled on 2008-09-23

GenBank Submission: BT044562.1

> FI04427.complete
GATTCATCGCATAATCTAGCGATAGCACGCGCAGATTTCCCACCATTCAT
TAAAAAAAATCCATTTCACATTAAACGACACCAGTGTGCAGCACGCTTGA
TTGGCGAGGGGAAATTTGTGGAAAAATTAAGTTCATTTAGAGACAGACGC
CGGCATTGCAAATATGTCCAAAACAGATACAGCTGCCGTGGAGGCAACCG
AAGAGAACTCGAACGAGACGACTTCAGATGCGGCCACCAGTTCATCCGGT
GAAAAGGAGGCTGAGTTCGACAACAAAATCGAGGCTGATCGCAGTAGGCG
CTTTGATTTCCTGCTAAAGCAGACGGAGATATTCACCCACTTCATGACTA
ACAGCGCTAAGAGTCCCACGAAGCCTAAGGGTAGACCCAAGAAGATCAAA
GACAAGGACAAGGAAAAGGATGTGGCCGATCATCGTCATCGCAAGACAGA
GCAGGAGGAGGATGAGGAGTTGCTGGCGGAAGACTCGGCCACCAAGGAGA
TCTTTCGCTTCGATGCCTCACCCGCCTACATCAAAAGTGGAGAGATGCGT
GACTACCAGATTCGCGGTCTTAACTGGATGATTTCGCTTTACGAAAATGG
TATCAATGGAATTCTGGCCGATGAAATGGGTCTAGGAAAGACCCTGCAGA
CCATATCTCTGCTGGGTTACCTCAAGCATTTCAAAAATCAAGCTGGACCA
CACATCGTCATCGTGCCAAAGTCAACGCTTCAGAATTGGGTAAATGAGTT
TAAAAAGTGGTGTCCTTCCCTCAGAGCCGTCTGCCTTATTGGTGACCAGG
ACACCCGTAACACCTTCATTAGAGATGTGCTCATGCCTGGCGAGTGGGAC
GTTTGCGTGACCTCCTATGAGATGTGTATCCGCGAGAAGTCTGTATTCAA
GAAGTTCAACTGGCGCTATTTGGTCATCGACGAGGCGCATCGTATCAAGA
ACGAGAAGTCGAAGCTGTCGGAGATTCTGCGAGAGTTTAAGACCGCTAAT
CGTCTACTTATCACGGGTACTCCGCTGCAGAATAACCTCCACGAGCTGTG
GGCCCTGCTTAATTTCCTGCTGCCCGATGTGTTTAATTCGTCAGAGGATT
TTGACGAATGGTTCAACACGAACACCTGCCTGGGTGACGATGCATTGATT
ACGCGTTTGCATGCCGTGCTGAAACCTTTCCTGCTCCGTCGTCTAAAGGC
CGAAGTGGAGAAGCGTCTGAAGCCGAAGAAGGAGATGAAAATATTTGTGG
GTCTATCCAAGATGCAACGCGACTGGTACACCAAGGTGCTGCTTAAGGAC
ATTGATGTAGTGAACGGTGCTGGCAAAGTGGAGAAGATGCGACTGCAGAA
CATCCTTATGCAGCTCCGCAAGTGCACCAACCACCCATATTTGTTTGATG
GCGCCGAGCCCGGTCCGCCATACACCACGGACACGCATTTGGTGTATAAC
TCCGGAAAGATGGCTATTCTGGACAAGCTGCTGCCCAAGCTCCAAGAGCA
GGGATCGCGTGTGTTGATTTTCTCACAAATGACGAGGATGTTGGATATCC
TCGAGGACTACTGTCACTGGCGCAACTACAACTATTGCCGCCTGGATGGT
CAGACGCCGCACGAAGATCGTAACAGGCAGATTCAGGAATTTAACATGGA
CAACAGCGCCAAGTTTCTCTTCATGTTGTCCACCCGAGCCGGTGGTTTGG
GTATCAATTTGGCTACCGCTGATGTTGTCATCATTTACGACTCGGATTGG
AATCCTCAAATGGATTTGCAAGCTATGGATCGTGCTCATCGTATTGGTCA
AAAGAAGCAAGTGCGCGTTTTCCGGCTGATCACCGAAAGTACAGTGGAGG
AGAAGATCGTGGAGAGAGCAGAGGTCAAGCTCCGTCTGGACAAGATGGTC
ATCCAGGGGGGCAGATTGGTTGACAACCGCTCCAATCAGTTGAACAAGGA
TGAAATGCTTAATATAATCCGTTTTGGAGCTAACCAAGTGTTCAGCTCTA
AGGAGACAGACATTACCGATGAGGACATCGATGTTATTTTGGAGCGCGGT
GAGGCCAAGACGGCCGAGCAAAAGGCAGCACTGGACAGTCTGGGCGAGAG
TTCGCTGCGGACGTTCACAATGGACACAAACGGCGAGGCAGGAACTTCTT
CCGTATATCAATTCGAGGGTGAGGATTGGCGCGAGAAGCAAAAGCTAAAT
GCGCTGGGCAACTGGATCGAGCCACCGAAGCGTGAACGCAAAGCCAACTA
TGCTGTGGATGCCTATTTCCGCGAGGCTCTCCGTGTCTCCGAACCCAAGG
CACCGAAGGCTCCCCGCCCACCCAAGCAGCCTATCGTTCAGGACTTTCAG
TTCTTCCCACCCCGTCTGTTTGAGCTGCTCGACCAGGAAATCTACTATTT
CCGCAAGACTGTTGGTTACAAGGTGCCCAAGAACACGGAACTAGGATCGG
ATGCCACCAAAGTGCAGCGCGAGGAGCAGCGCAAGATCGATGAGGCAGAG
CCGCTTACCGAGGAAGAGATCCAGGAGAAGGAGAATCTACTCTCACAGGG
TTTCACTGCCTGGACCAAGCGCGATTTCAACCAGTTCATCAAGGCTAACG
AAAAGTACGGTCGGGATGATATTGACAACATTGCCAAGGACGTGGAGGGC
AAGACTCCGGAGGAGGTTATCGAGTACAACGCCGTGTTTTGGGAGCGATG
CACTGAGTTGCAGGATATTGAGCGAATAATGGGACAGATTGAGCGTGGAG
AGGGCAAGATTCAACGGCGATTGTCTATTAAGAAGGCTTTGGATCAAAAG
ATGTCGCGGTATCGCGCCCCCTTCCATCAGTTGCGGCTGCAATATGGTAA
TAACAAGGGCAAGAATTACACTGAAATAGAGGATCGCTTTCTGGTATGCA
TGCTTCACAAGTTGGGCTTTGACAAGGAGAATGTCTACGAAGAGCTGCGA
GCGGCTATAAGAGCTTCTCCGCAATTCCGCTTTGACTGGTTCATCAAATC
TAGAACCGCTTTGGAGCTACAGCGTCGCTGCAACACGTTGATTACCCTTA
TTGAACGTGAAAACATTGAGCTGGAAGAGAAAGAACGCGCCGAGAAAAAG
AAAAAGGCACCAAAGGGCAGCGTGTCCGCTGGAAGTGGAAGTGCCAGCTC
GAACACTCCAGCACCCGCGCCCCAACCGAAGGCCAGTCAAAAGCGGAAGA
GCGAGGTGGTGGCAACCAGTTCCAACTCGAAAAAGAAGAAGAAGTAAAGC
GACAAAGCAAACAGATATTTTTCTGAGATTCGGCTCTACACTCAGCACTA
GGCAGTTAAATAGTTAAGACAAGCGATTACTTAAACATATTTTACTCTAT
ATAGTTAATAGTTCATATCTCACGCCGGAAGCAATATCACACCAACCCCA
CCCCCAAAATCTGAAGTTTTTTTAAACACCCGCCTACACATCCGACTACA
TTACTATTGGGTGCCGCTGTATTCTATTCCAAATAATTGTATTGTGTTCT
AAGACTATAATCATTATATTTATATAAATCAACACAGCAAAAAAAAAAAA
AAAA

FI04427.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
Iswi-RA 3705 Iswi-RA 227..3701 65..3539 17360 99.9 Plus
Iswi.b 3626 Iswi.b 153..3626 65..3538 17355 99.9 Plus
Iswi.a 3614 Iswi.a 141..3614 65..3538 17355 99.9 Plus
Iswi-RA 3705 Iswi-RA 57..116 2..61 300 100 Plus
Iswi.b 3626 Iswi.b 57..116 2..61 300 100 Plus
Iswi.a 3614 Iswi.a 57..116 2..61 300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8524911..8527026 685..2800 10265 99 Plus
chr2R 21145070 chr2R 8527306..8527884 2960..3538 2835 99.3 Plus
chr2R 21145070 chr2R 8524595..8524849 430..684 1275 100 Plus
chr2R 21145070 chr2R 8524309..8524527 211..429 1080 99.5 Plus
chr2R 21145070 chr2R 8527084..8527246 2799..2961 815 100 Plus
chr2R 21145070 chr2R 8524100..8524246 65..211 735 100 Plus
chr2R 21145070 chr2R 8523930..8523989 2..61 300 100 Plus
chr3L 24539361 chr3L 15961531..15961650 1801..1682 225 79.2 Minus
chr3L 24539361 chr3L 15962391..15962461 1075..1005 190 84.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
Iswi-RC 3084 CG8625-PC 1..3084 164..3247 15420 100 Plus
Iswi-RB 3084 CG8625-PB 1..3084 164..3247 15420 100 Plus
Iswi-RA 3084 CG8625-PA 1..3084 164..3247 15420 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:35 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
Iswi-RB 3541 CG8625-RB 4..3541 2..3538 17625 99.9 Plus
Iswi-RC 3585 CG8625-RC 111..3585 64..3538 17360 100 Plus
Iswi-RA 3647 CG8625-RA 174..3647 65..3538 17355 100 Plus
Iswi-RC 3585 CG8625-RC 4..63 2..61 300 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Iswi-PC 1027 CG8625-PC 1..970 164..3073 4613 100 Plus
Iswi-PB 1027 CG8625-PB 1..970 164..3073 4613 100 Plus
Iswi-PA 1027 CG8625-PA 1..970 164..3073 4613 100 Plus
brm-PD 1634 CG5942-PD 766..1264 536..1969 1133 46.9 Plus
brm-PC 1634 CG5942-PC 766..1264 536..1969 1133 46.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:45:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12637655..12639770 685..2800 10580 100 Plus
2R 25286936 2R 12640050..12640629 2960..3539 2885 99.8 Plus
2R 25286936 2R 12637339..12637593 430..684 1275 100 Plus
2R 25286936 2R 12637053..12637271 211..429 1095 100 Plus
2R 25286936 2R 12639828..12639990 2799..2961 815 100 Plus
2R 25286936 2R 12636844..12636990 65..211 735 100 Plus
2R 25286936 2R 12636674..12636733 2..61 300 100 Plus
3L 28110227 3L 15971715..15971834 1801..1682 225 79.2 Minus
3L 28110227 3L 15972580..15972650 1075..1005 190 84.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12638854..12640969 685..2800 10580 100 Plus
2R 25260384 2R 12641249..12641828 2960..3539 2885 99.8 Plus
2R 25260384 2R 12638538..12638792 430..684 1275 100 Plus
2R 25260384 2R 12638252..12638470 211..429 1095 100 Plus
2R 25260384 2R 12641027..12641189 2799..2961 815 100 Plus
2R 25260384 2R 12638043..12638189 65..211 735 100 Plus
2R 25260384 2R 12637873..12637932 2..61 300 100 Plus
3L 28103327 3L 15964815..15964934 1801..1682 225 79.1 Minus
3L 28103327 3L 15965680..15965750 1075..1005 190 84.5 Minus
3L 28103327 3L 19878108..19878201 1755..1662 185 79.7 Minus
3L 28103327 3L 19878304..19878355 1559..1508 155 86.5 Minus
Blast to na_te.dros performed on 2014-11-26 19:45:07 has no hits.

FI04427.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:59:07 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8527308..8527884 2962..3538 99   Plus
chr2R 8527086..8527246 2801..2961 100 -> Plus
chr2R 8524911..8527026 685..2800 99 -> Plus
chr2R 8524595..8524849 430..684 100 -> Plus
chr2R 8524310..8524527 212..429 99 -> Plus
chr2R 8524100..8524246 65..211 100 -> Plus
chr2R 8523928..8523993 1..64 96 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:47:48 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RC 1..3084 164..3247 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:13:18 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RC 1..3084 164..3247 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:29:34 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RA 1..3084 164..3247 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:59:07 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RA 1..3084 164..3247 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:51:15 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RB 17..3556 1..3538 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:13:18 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RB 17..3556 1..3538 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:29:34 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RB 2..3541 1..3538 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 15:42:04 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RB 17..3556 1..3538 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:59:07 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
Iswi-RB 2..3541 1..3538 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:59:07 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12640052..12640628 2962..3538 99   Plus
2R 12639830..12639990 2801..2961 100 -> Plus
2R 12637655..12639770 685..2800 100 -> Plus
2R 12637339..12637593 430..684 100 -> Plus
2R 12637054..12637271 212..429 100 -> Plus
2R 12636844..12636990 65..211 100 -> Plus
2R 12636672..12636737 1..64 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:29:34 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8527557..8528133 2962..3538 99   Plus
arm_2R 8527335..8527495 2801..2961 100 -> Plus
arm_2R 8525160..8527275 685..2800 100 -> Plus
arm_2R 8524844..8525098 430..684 100 -> Plus
arm_2R 8524559..8524776 212..429 100 -> Plus
arm_2R 8524349..8524495 65..211 100 -> Plus
arm_2R 8524177..8524242 1..64 96 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:43:54 Download gff for FI04427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12641251..12641827 2962..3538 99   Plus
2R 12641029..12641189 2801..2961 100 -> Plus
2R 12638854..12640969 685..2800 100 -> Plus
2R 12638538..12638792 430..684 100 -> Plus
2R 12638253..12638470 212..429 100 -> Plus
2R 12638043..12638189 65..211 100 -> Plus
2R 12637871..12637936 1..64 96 -> Plus

FI04427.pep Sequence

Translation from 163 to 3246

> FI04427.pep
MSKTDTAAVEATEENSNETTSDAATSSSGEKEAEFDNKIEADRSRRFDFL
LKQTEIFTHFMTNSAKSPTKPKGRPKKIKDKDKEKDVADHRHRKTEQEED
EELLAEDSATKEIFRFDASPAYIKSGEMRDYQIRGLNWMISLYENGINGI
LADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWC
PSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKSVFKKFNW
RYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLN
FLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKPFLLRRLKAEVEK
RLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVVNGAGKVEKMRLQNILMQ
LRKCTNHPYLFDGAEPGPPYTTDTHLVYNSGKMAILDKLLPKLQEQGSRV
LIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAK
FLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQV
RVFRLITESTVEEKIVERAEVKLRLDKMVIQGGRLVDNRSNQLNKDEMLN
IIRFGANQVFSSKETDITDEDIDVILERGEAKTAEQKAALDSLGESSLRT
FTMDTNGEAGTSSVYQFEGEDWREKQKLNALGNWIEPPKRERKANYAVDA
YFREALRVSEPKAPKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTV
GYKVPKNTELGSDATKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAW
TKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQ
DIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGK
NYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTAL
ELQRRCNTLITLIERENIELEEKERAEKKKKAPKGSVSAGSGSASSNTPA
PAPQPKASQKRKSEVVATSSNSKKKKK*

FI04427.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13400-PA 1027 GF13400-PA 1..1022 1..1022 4995 97.6 Plus
Dana\GF10366-PA 1635 GF10366-PA 766..1264 125..602 1177 46.7 Plus
Dana\GF14337-PA 1891 GF14337-PA 512..1060 115..643 1113 42.9 Plus
Dana\GF10842-PA 1971 GF10842-PA 700..1214 115..610 1047 41.8 Plus
Dana\GF24504-PA 3217 GF24504-PA 2008..2545 115..628 1045 41.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20326-PA 1027 GG20326-PA 1..1027 1..1027 5499 99.3 Plus
Dere\GG13509-PA 1634 GG13509-PA 766..1264 125..602 1176 46.9 Plus
Dere\GG24470-PA 1886 GG24470-PA 514..1091 115..682 1115 41.9 Plus
Dere\GG24671-PA 5335 GG24671-PA 2024..2561 115..628 1052 41.8 Plus
Dere\Chd3-PA 869 GG16034-PA 226..787 115..658 982 38 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23147-PA 1025 GH23147-PA 1..1025 1..1027 4987 94.8 Plus
Dgri\GH16759-PA 1716 GH16759-PA 835..1333 125..602 1181 46.9 Plus
Dgri\GH10643-PA 1931 GH10643-PA 540..1088 115..643 1053 42.5 Plus
Dgri\GH10228-PA 5820 GH10228-PA 2296..2833 115..628 1051 41.6 Plus
Dgri\GH16907-PA 2013 GH16907-PA 714..1232 115..616 1039 41.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Iswi-PC 1027 CG8625-PC 1..1027 1..1027 5339 100 Plus
Iswi-PB 1027 CG8625-PB 1..1027 1..1027 5339 100 Plus
Iswi-PA 1027 CG8625-PA 1..1027 1..1027 5339 100 Plus
brm-PD 1634 CG5942-PD 699..1292 74..630 1147 41.6 Plus
brm-PC 1634 CG5942-PC 699..1292 74..630 1147 41.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18485-PA 1020 GI18485-PA 1..1020 1..1027 4993 95.3 Plus
Dmoj\GI18484-PA 603 GI18484-PA 4..602 91..693 2259 68.7 Plus
Dmoj\GI13420-PA 1723 GI13420-PA 849..1347 125..602 1180 46.7 Plus
Dmoj\GI10771-PA 1908 GI10771-PA 527..1075 115..643 1095 42.6 Plus
Dmoj\GI13663-PA 1992 GI13663-PA 706..1220 115..610 1050 41.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11075-PA 1033 GL11075-PA 1..1024 1..1018 4901 94.5 Plus
Dper\GL26702-PA 1943 GL26702-PA 547..1096 115..643 1107 43.3 Plus
Dper\GL22908-PA 1898 GL22908-PA 579..1097 115..616 1030 41.7 Plus
Dper\GL19201-PA 833 GL19201-PA 267..786 120..579 869 38.3 Plus
Dper\GL12823-PA 373 GL12823-PA 34..343 121..415 694 45.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21216-PA 1035 GA21216-PA 1..1026 1..1018 4940 95 Plus
Dpse\GA28654-PA 1677 GA28654-PA 803..1305 121..602 1183 46.7 Plus
Dpse\GA17649-PA 1943 GA17649-PA 547..1096 115..643 1107 43.3 Plus
Dpse\GA17619-PA 5605 GA17619-PA 2125..2662 115..628 1054 41.9 Plus
Dpse\GA23929-PA 2036 GA23929-PA 721..1239 115..616 1032 41.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21414-PA 1027 GM21414-PA 1..1027 1..1027 5515 99.7 Plus
Dsec\GM24456-PA 1638 GM24456-PA 770..1268 125..602 1175 47.1 Plus
Dsec\Chd3-PA 882 GM19418-PA 253..775 115..621 974 40.2 Plus
Dsec\GM15785-PA 1921 GM15785-PA 678..1168 115..610 926 39 Plus
Dsec\GM12170-PA 611 GM12170-PA 47..564 120..577 824 38.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10909-PA 1001 GD10909-PA 1..996 1..1022 4894 96 Plus
Dsim\Chd3-PA 893 GD14801-PA 253..775 115..621 1023 40.3 Plus
Dsim\GD22327-PA 847 GD22327-PA 283..800 120..577 837 38.3 Plus
Dsim\GD11588-PA 1353 GD11588-PA 921..1222 128..423 689 43.9 Plus
Dsim\GD19063-PA 1403 GD19063-PA 788..1363 94..618 653 33 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21347-PA 1021 GJ21347-PA 1..1021 1..1027 5025 95.5 Plus
Dvir\GJ21345-PA 714 GJ21345-PA 1..706 1..697 2861 75 Plus
Dvir\GJ11780-PA 1679 GJ11780-PA 801..1303 121..602 1184 46.7 Plus
Dvir\GJ18281-PA 1924 GJ18281-PA 539..1087 115..643 1099 42.4 Plus
Dvir\GJ17250-PA 5552 GJ17250-PA 2199..2736 115..628 1048 41.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21565-PA 1026 GK21565-PA 1..1021 1..1022 5014 96.2 Plus
Dwil\GK23635-PA 1720 GK23635-PA 839..1337 125..602 1177 46.7 Plus
Dwil\GK15574-PA 1941 GK15574-PA 536..1109 115..660 1114 42.2 Plus
Dwil\GK18181-PA 5689 GK18181-PA 2191..2728 115..628 1051 41.8 Plus
Dwil\GK17504-PA 2023 GK17504-PA 726..1244 115..616 1042 41.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12485-PA 1027 GE12485-PA 1..1027 1..1027 5501 99.3 Plus
Dyak\GE23128-PA 1634 GE23128-PA 766..1264 125..602 1175 46.9 Plus
Dyak\GE22814-PA 611 GE22814-PA 3..501 125..602 1166 46.9 Plus
Dyak\GE14968-PA 1883 GE14968-PA 513..1090 115..682 1120 42.1 Plus
Dyak\GE16349-PA 5330 GE16349-PA 2017..2554 115..628 1051 41.8 Plus

FI04427.hyp Sequence

Translation from 163 to 3246

> FI04427.hyp
MSKTDTAAVEATEENSNETTSDAATSSSGEKEAEFDNKIEADRSRRFDFL
LKQTEIFTHFMTNSAKSPTKPKGRPKKIKDKDKEKDVADHRHRKTEQEED
EELLAEDSATKEIFRFDASPAYIKSGEMRDYQIRGLNWMISLYENGINGI
LADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWC
PSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKSVFKKFNW
RYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLN
FLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKPFLLRRLKAEVEK
RLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVVNGAGKVEKMRLQNILMQ
LRKCTNHPYLFDGAEPGPPYTTDTHLVYNSGKMAILDKLLPKLQEQGSRV
LIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAK
FLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQV
RVFRLITESTVEEKIVERAEVKLRLDKMVIQGGRLVDNRSNQLNKDEMLN
IIRFGANQVFSSKETDITDEDIDVILERGEAKTAEQKAALDSLGESSLRT
FTMDTNGEAGTSSVYQFEGEDWREKQKLNALGNWIEPPKRERKANYAVDA
YFREALRVSEPKAPKAPRPPKQPIVQDFQFFPPRLFELLDQEIYYFRKTV
GYKVPKNTELGSDATKVQREEQRKIDEAEPLTEEEIQEKENLLSQGFTAW
TKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQ
DIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGK
NYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTAL
ELQRRCNTLITLIERENIELEEKERAEKKKKAPKGSVSAGSGSASSNTPA
PAPQPKASQKRKSEVVATSSNSKKKKK*

FI04427.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Iswi-PC 1027 CG8625-PC 1..1027 1..1027 5339 100 Plus
Iswi-PB 1027 CG8625-PB 1..1027 1..1027 5339 100 Plus
Iswi-PA 1027 CG8625-PA 1..1027 1..1027 5339 100 Plus
brm-PD 1634 CG5942-PD 699..1292 74..630 1147 41.6 Plus
brm-PC 1634 CG5942-PC 699..1292 74..630 1147 41.6 Plus