Clone FI04444 Report

Search the DGRC for FI04444

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:44
Vector:pFlc-1
Associated Gene/TranscriptCG9498-RA
Protein status:FI04444.pep: gold
Sequenced Size:1524

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9498 2008-12-18 5.12 accounting

Clone Sequence Records

FI04444.complete Sequence

1524 bp assembled on 2008-09-12

GenBank Submission: BT044188.1

> FI04444.complete
GAGTTGGCTACGAAAGGCAAGCGTTAAGGTTTCGATCGGAGGTGTATCGC
TTTAGTTAGAGATTCGAAATGGTGGTCATTAAGAACGAGCAGAATATCTC
GGTGCCCGAGTATCTCAACGAGCACTTCTTCACAGAGACCCTGGAGGAGG
GTTTGCGGGAGTCGAAGGTGACCCTGAAGGAGATCAATTTTGCGTGGGGC
AGCAATCCGGGGGACAACTATTGCTCGGCTATCTATCGTGTCGGAGTCTC
GTTCGCTAGATGGGCCGACGGTGGGGAATCCCCGGTGACGGAGCAGCTTT
CGCTAATTGTGAAGACCATTCCGATCACCGAAGCCACTCAGTTTCTGGAG
GATGTCTGTGTGTTCATCAAGGAGAAGCAGACCTACACTGATGTCTTGCC
GCGATTGGATATCCTCAGCCGTGGCGACACATTCGGAGCAAAATACTATC
ACTCTGTGAAGACTCCGGTGCAAACGATCGTGTTCAGTGACCTCACGGTA
GAGGGATTCAAGGTGGCCTCGCGTGAAAAAGGCCTGGACTGGAACCACGC
CTCACTCATTCTTCAGCAACTGGGAAAGTTCCATGCCACCTCCATGGTGC
TGGCCAAGAAGGATCCCGCTATTGTGAAGCAATACACGCGTGGCATGCTC
AGCGAGGACATCCTGATGAAGAGCGACACCTTCGAGCAAATGTTCGGCGG
CTTCCTCAAGGGCCTCATCAAGAGCTCAGCGAGCTGGGCCGGCTACGAGA
AGATTAGCAAGCACTTGCAGCGCCTTATGGACAACTTCCGGAACGTGTGT
GCGGATGCGCCCAGGCCGAGGAAGGGTGATCGCTACGTGGTGCTCAACCA
CGGGGATTTGTGGACCAATAACTTCATGTACGGATACGATAACGCTTCAC
AGCCGGACGTTCCCACGCGTGCCATCTTCGTGGACTTCCAACTCAGCTTC
TATGGCAGTCCGGCCTGCGATCTGAACTTCTTCCTGAACACCAGCATCAA
GCTGCAATTGCTGCAGGAGCGCCGCGAGGAGCTCATCAAGGTGTACTATG
CATCCTTCAAGGATGCTCTGGAGTACGCCCGCTTCGAGGACATTCCCAGC
TATGAGGATCTGCAGTACGAGCTGCGCAGCCGCGAAACCTACGGACTTTT
CGGCATGTTCGCCTTCCTGCCCATGATCACCATGCCCAAGGAGCTGGCCC
AGGACAACAGCATTGAGAACATGCAGGACGAGGCCTTCAAGCAGCGCAAG
ATGGATGCCATCTTCTCGCAAAAGTTCCTGAACGACCACCAAAAGTGGGC
TCTGAAGCGAGCTGATTCACTTGGCGTCTTCGGGGACTACTGAAAAGTGG
CATGAGTATTATAATGGTTGGGGTTCTGTGATATAAATGGAGGCTCTTCC
AAGGCACACATCCTTGATATAGCTATATTAGCTTTCGGCCTGAGAATGTA
AATGTTTTGGATTGATTAAAGTACCAAACCTGACTTCAATGCAATAAATC
AAACTAACGAAAAAAAAAAAAAAA

FI04444.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9498-RA 1540 CG9498-RA 26..1536 2..1512 7555 100 Plus
CG13360-RA 1726 CG13360-RA 1038..1122 920..1004 185 81.1 Plus
CG13360-RA 1726 CG13360-RA 694..737 570..613 145 88.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6348407..6349306 1509..610 4485 99.9 Minus
chr2L 23010047 chr2L 6349602..6350042 442..2 2205 100 Minus
chr2L 23010047 chr2L 6349368..6349537 612..443 850 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG9498-RA 1275 CG9498-PA 1..1275 69..1343 6375 100 Plus
CG13360-RA 1266 CG13360-PA 846..930 920..1004 185 81.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG9498-RA 1514 CG9498-RA 7..1514 2..1509 7540 100 Plus
CG13360-RA 1603 CG13360-RA 921..1005 920..1004 185 81.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG9498-PA 424 CG9498-PA 1..424 69..1340 2155 100 Plus
CG13360-PA 421 CG13360-PA 15..420 105..1331 904 47.1 Plus
CG9497-PB 417 CG9497-PB 11..415 96..1328 714 40.1 Plus
CG9497-PA 417 CG9497-PA 11..415 96..1328 714 40.1 Plus
CG7135-PA 417 CG7135-PA 9..416 105..1331 589 36.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6349390..6350292 1512..610 4515 100 Minus
2L 23513712 2L 6350588..6351028 442..2 2205 100 Minus
2L 23513712 2L 6350354..6350523 612..443 850 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6349390..6350292 1512..610 4515 100 Minus
2L 23513712 2L 6350588..6351028 442..2 2205 100 Minus
2L 23513712 2L 6350354..6350523 612..443 850 100 Minus
X 23527363 X 796551..796625 1004..930 150 80 Minus
X 23527363 X 797569..797611 612..570 140 88.3 Minus
Blast to na_te.dros performed on 2014-11-27 10:43:18 has no hits.

FI04444.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:48:52 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6349602..6350042 1..442 99   Minus
chr2L 6349369..6349537 443..611 100 <- Minus
chr2L 6348407..6349304 612..1509 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:47:59 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 1..1275 69..1343 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:00:54 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 1..1275 69..1343 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:19:12 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 1..1275 69..1343 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:48:52 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 1..1275 69..1343 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:19:05 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 1..1508 2..1509 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:00:54 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 1..1508 2..1509 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:19:12 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 6..1514 1..1509 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-12 15:54:37 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 1..1508 2..1509 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:48:52 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
CG9498-RA 6..1514 1..1509 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:48:52 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6350588..6351028 1..442 99   Minus
2L 6350355..6350523 443..611 100 <- Minus
2L 6349393..6350290 612..1509 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:19:12 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6350588..6351028 1..442 99   Minus
arm_2L 6350355..6350523 443..611 100 <- Minus
arm_2L 6349393..6350290 612..1509 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:28:06 Download gff for FI04444.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6350588..6351028 1..442 99   Minus
2L 6350355..6350523 443..611 100 <- Minus
2L 6349393..6350290 612..1509 100 <- Minus

FI04444.pep Sequence

Translation from 68 to 1342

> FI04444.pep
MVVIKNEQNISVPEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDN
YCSAIYRVGVSFARWADGGESPVTEQLSLIVKTIPITEATQFLEDVCVFI
KEKQTYTDVLPRLDILSRGDTFGAKYYHSVKTPVQTIVFSDLTVEGFKVA
SREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGMLSEDILM
KSDTFEQMFGGFLKGLIKSSASWAGYEKISKHLQRLMDNFRNVCADAPRP
RKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPAC
DLNFFLNTSIKLQLLQERREELIKVYYASFKDALEYARFEDIPSYEDLQY
ELRSRETYGLFGMFAFLPMITMPKELAQDNSIENMQDEAFKQRKMDAIFS
QKFLNDHQKWALKRADSLGVFGDY*

FI04444.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21277-PA 424 GF21277-PA 1..424 1..424 2064 89.4 Plus
Dana\GF21080-PA 429 GF21080-PA 23..428 13..421 961 47.1 Plus
Dana\GF21041-PA 929 GF21041-PA 1..183 1..181 777 80.9 Plus
Dana\GF15396-PA 417 GF15396-PA 1..417 1..422 775 38.9 Plus
Dana\GF15395-PA 417 GF15395-PA 9..416 13..421 640 35.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23631-PA 424 GG23631-PA 1..424 1..424 2165 93.6 Plus
Dere\GG12743-PA 421 GG12743-PA 15..420 13..421 941 46.4 Plus
Dere\GG23632-PA 417 GG23632-PA 11..417 10..422 770 39.9 Plus
Dere\GG19151-PA 417 GG19151-PA 9..416 13..421 677 37.5 Plus
Dere\GG11390-PA 433 GG11390-PA 25..391 12..383 436 31.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10993-PA 424 GH10993-PA 1..424 1..424 1820 76.4 Plus
Dgri\GH17854-PA 417 GH17854-PA 10..417 13..423 980 47.8 Plus
Dgri\GH10995-PA 424 GH10995-PA 17..422 13..421 751 38.3 Plus
Dgri\GH10994-PA 417 GH10994-PA 7..416 11..421 617 35.2 Plus
Dgri\GH14824-PA 419 GH14824-PA 10..366 10..370 422 30.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9498-PA 424 CG9498-PA 1..424 1..424 2217 100 Plus
CG13360-PA 421 CG13360-PA 15..420 13..421 937 47.1 Plus
CG9497-PB 417 CG9497-PB 11..415 10..420 752 40.1 Plus
CG9497-PA 417 CG9497-PA 11..415 10..420 752 40.1 Plus
CG7135-PA 417 CG7135-PA 9..416 13..421 635 36.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17508-PA 424 GI17508-PA 1..424 1..424 1732 73.6 Plus
Dmoj\GI10995-PA 419 GI10995-PA 13..418 13..421 941 46.1 Plus
Dmoj\GI17510-PA 418 GI17510-PA 4..417 2..421 773 41.5 Plus
Dmoj\GI17509-PA 417 GI17509-PA 8..416 12..421 641 34.8 Plus
Dmoj\GI23684-PA 415 GI23684-PA 3..385 11..393 376 29.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26272-PA 424 GL26272-PA 1..424 1..424 1948 84.4 Plus
Dper\GL26274-PA 418 GL26274-PA 14..417 13..421 732 38.5 Plus
Dper\GL26273-PA 418 GL26273-PA 9..417 12..421 654 35 Plus
Dper\GL26872-PA 209 GL26872-PA 1..208 213..421 512 48.6 Plus
Dper\GL21713-PA 420 GL21713-PA 6..395 6..399 391 27.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21834-PA 424 GA21834-PA 1..424 1..424 1956 84.7 Plus
Dpse\GA12229-PA 425 GA12229-PA 19..424 13..421 958 46.8 Plus
Dpse\GA21833-PA 418 GA21833-PA 14..417 13..421 729 38.5 Plus
Dpse\GA28103-PA 418 GA28103-PA 9..417 12..421 654 35 Plus
Dpse\GA11254-PA 420 GA11254-PA 6..395 6..399 392 27.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17948-PA 424 GM17948-PA 1..424 1..424 2223 96.2 Plus
Dsec\GM19022-PA 421 GM19022-PA 15..420 13..421 951 46.6 Plus
Dsec\GM17950-PA 417 GM17950-PA 11..416 10..421 765 39.8 Plus
Dsec\GM22881-PA 417 GM22881-PA 9..416 13..421 655 36.5 Plus
Dsec\GM17833-PA 420 GM17833-PA 12..378 12..383 434 31.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22587-PA 424 GD22587-PA 1..424 1..424 2252 97.6 Plus
Dsim\GD22588-PA 383 GD22588-PA 11..382 10..421 694 36.7 Plus
Dsim\GD24685-PA 417 GD24685-PA 9..416 13..421 662 36.8 Plus
Dsim\GD16460-PA 270 GD16460-PA 31..269 182..421 546 44.8 Plus
Dsim\GD21199-PA 417 GD21199-PA 9..365 12..371 415 28.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15227-PA 424 GJ15227-PA 1..424 1..424 1846 79 Plus
Dvir\GJ19105-PA 425 GJ19105-PA 13..424 13..421 933 46.2 Plus
Dvir\GJ15249-PA 422 GJ15249-PA 4..421 2..421 800 41.2 Plus
Dvir\GJ15238-PA 417 GJ15238-PA 7..416 11..421 648 35.6 Plus
Dvir\GJ24002-PA 435 GJ24002-PA 28..380 10..369 405 29 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15366-PA 424 GK15366-PA 1..424 1..424 1853 78.8 Plus
Dwil\GK19796-PA 429 GK19796-PA 24..428 13..421 932 46.4 Plus
Dwil\GK15368-PA 421 GK15368-PA 4..420 2..421 763 39.4 Plus
Dwil\GK15367-PA 419 GK15367-PA 6..418 10..421 633 33.3 Plus
Dwil\GK12928-PA 436 GK12928-PA 20..381 2..369 402 28.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18452-PA 424 GE18452-PA 1..424 1..424 2189 94.8 Plus
Dyak\GE16568-PA 421 GE16568-PA 15..420 13..421 952 46.8 Plus
Dyak\GE18453-PA 417 GE18453-PA 11..416 10..421 758 39.3 Plus
Dyak\GE17710-PA 417 GE17710-PA 9..416 13..421 676 37.7 Plus
Dyak\GE23588-PA 421 GE23588-PA 12..366 12..369 415 30.5 Plus

FI04444.hyp Sequence

Translation from 68 to 1342

> FI04444.hyp
MVVIKNEQNISVPEYLNEHFFTETLEEGLRESKVTLKEINFAWGSNPGDN
YCSAIYRVGVSFARWADGGESPVTEQLSLIVKTIPITEATQFLEDVCVFI
KEKQTYTDVLPRLDILSRGDTFGAKYYHSVKTPVQTIVFSDLTVEGFKVA
SREKGLDWNHASLILQQLGKFHATSMVLAKKDPAIVKQYTRGMLSEDILM
KSDTFEQMFGGFLKGLIKSSASWAGYEKISKHLQRLMDNFRNVCADAPRP
RKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQLSFYGSPAC
DLNFFLNTSIKLQLLQERREELIKVYYASFKDALEYARFEDIPSYEDLQY
ELRSRETYGLFGMFAFLPMITMPKELAQDNSIENMQDEAFKQRKMDAIFS
QKFLNDHQKWALKRADSLGVFGDY*

FI04444.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG9498-PA 424 CG9498-PA 1..424 1..424 2217 100 Plus
CG13360-PA 421 CG13360-PA 15..420 13..421 937 47.1 Plus
CG9497-PB 417 CG9497-PB 11..415 10..420 752 40.1 Plus
CG9497-PA 417 CG9497-PA 11..415 10..420 752 40.1 Plus
CG7135-PA 417 CG7135-PA 9..416 13..421 635 36.3 Plus