Clone FI04445 Report

Search the DGRC for FI04445

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:45
Vector:pFlc-1
Associated Gene/TranscriptCG12038-RA
Protein status:FI04445.pep: gold
Sequenced Size:1463

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12038 2008-12-18 5.12 accounting

Clone Sequence Records

FI04445.complete Sequence

1463 bp assembled on 2008-09-15

GenBank Submission: BT044499.1

> FI04445.complete
GTTATACCCGTACCTTCGATGGGGTGTGTAAGCAAGCTGGTTAAAAATGG
AAATCTCTGGCTTTTAAAATGTTGACCGCCCTGCGTCGGAAAATTCGGTT
CGGAATGCAGCGCACGGTTTTAATTGCGGTCCTGCTGGCGGTGGGCATTT
TCAGCTACGCCTTTCTCAACCTCAAGTTCTGCTTCAAGTTGATGTCCCAT
CGGAGCCTCAACTTGATGTGCCAGAAATTCGAAAAACATGAGTACAGCGG
CTCTCTGTGTGAGGAACTCTGTGGTTCCCAATCTTCCTTCGACAACTTTC
AGTGTCCGCTGAATGATATGAAAACTATCCTCTTTACGGCCGAAAAGAAC
GGCGACTTGTATGCGGTGAAGCTGGCCCGGCACAACGATGACGAGCTGAG
CTGGACGAACAACAAGGGGGAGTCGATATACCCCAAGCTCGAGGAGTTCC
ACGAGATCGTGAAGCTGCACATCATTCTGGCGTACAATGTCACCCTGGAT
GATAATATGATCCGCGCTCTGGTCAACCAGGAAATAGCCGATGATAACTC
GCAGCAGATGGTCAGTTTTTGGCGGCTCTTCAAGGACAACAACTACATGA
TGGGCAAACTTTTCGACGAGGAATCCATCTTTCCGGCTGTGCTGGGCTCC
TGTGGACCCTACTACGCCACTGAGGGACTGGAGATTGTGCAGTCCAACCC
CAGCATAATGCAGTATCTGGCCTCCAATCGCGTGCAGCGGCTGAAGCATG
CTCTCAATATTATGGAGTACATTTTCCGACTGGACGAAATGAAGCCGGAG
CCGCTGAAGATGTGCAAGATGCAGGTGAATCGCTTCGGAACCGCCTCTGA
GCGAAGACTGAAGTACCAGAGTGCCGAGCACGTCTATGTGGAGAGCCAGC
TGGACAAGCGATTGTCCAGGGGCGTCAAGTGCCACGCCCACCAGGACTGC
CACTTCCACTCCTGCCGAGGATTGTGTGACGAGGAGAAGCAATCCTGCAC
GCACATTCAGCAGAACAACAACTTCCAGATTTTCTGCGAGCACATCCTAC
TGGGCGGAGGCACATTTCAGCCCGGCCTCCTCAGCGGAGTGCGCCTCTCC
AAGGCGCTCCAGAAGCTGGTCAAGATGTGCGTCCAGCCGCCCAAGGAGCA
TCAAGTGCCAGGACGCCAGTGGGCACCCAACACGCAGCTCGCCCTGAGGC
TCTACAACGAGCTGAAGCAACTGCATCAGGCTGCAACAGCATCCGCAGGA
TCCGTGATTCCCGACGAGGGACAGGCACGTCGGGGAGTCTAAAACATTCG
GGGATTGGTACGGAAGTCGGAGAAGCTCGGAAGCAGCGGACGGTAGATCA
ATTGGCGTACAGCTGGCTCAAAACTGATAGCATTTTTATAAGTAGACTTA
ATTAATTACAAGTAAATAAAACAAAAATGCTTTTTTTGACTACAACAAAA
AAAAAAAAAAAAA

FI04445.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG12038-RA 1506 CG12038-RA 53..1504 3..1454 7245 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 994702..995430 719..1446 3400 98.1 Plus
chr3L 24539361 chr3L 994433..994643 509..719 1055 100 Plus
chr3L 24539361 chr3L 993721..993936 3..218 1050 99.1 Plus
chr3L 24539361 chr3L 994002..994155 218..371 755 99.4 Plus
chr3L 24539361 chr3L 994227..994366 370..509 685 99.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG12038-RA 1224 CG12038-PA 1..1224 69..1292 6120 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:42 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG12038-RA 1456 CG12038-RA 13..1456 3..1446 7220 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG12038-PA 407 CG12038-PA 1..407 69..1289 2148 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 994976..995711 719..1454 3665 99.9 Plus
3L 28110227 3L 993995..994210 3..218 1080 100 Plus
3L 28110227 3L 994707..994917 509..719 1055 100 Plus
3L 28110227 3L 994276..994429 218..371 770 100 Plus
3L 28110227 3L 994501..994640 370..509 700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 994976..995711 719..1454 3665 99.8 Plus
3L 28103327 3L 993995..994210 3..218 1080 100 Plus
3L 28103327 3L 994707..994917 509..719 1055 100 Plus
3L 28103327 3L 994276..994429 218..371 770 100 Plus
3L 28103327 3L 994501..994640 370..509 700 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:37:16 has no hits.

FI04445.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:57:20 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 994702..995430 719..1446 98   Plus
chr3L 994434..994642 510..718 100 -> Plus
chr3L 994229..994366 372..509 99 -> Plus
chr3L 994003..994155 219..371 99 -> Plus
chr3L 993718..993936 1..218 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:48:00 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 1..1224 69..1292 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:01:43 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 1..1224 69..1292 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:42 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 1..1224 69..1292 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:57:20 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 1..1224 69..1292 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:20:12 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 5..1451 1..1446 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:01:42 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 5..1451 1..1446 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:42 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 10..1456 1..1446 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-15 12:14:05 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 5..1451 1..1446 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:57:20 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
CG12038-RA 10..1456 1..1446 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:57:20 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
3L 994976..995703 719..1446 100   Plus
3L 994708..994916 510..718 100 -> Plus
3L 994503..994640 372..509 100 -> Plus
3L 994277..994429 219..371 100 -> Plus
3L 993992..994210 1..218 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:42 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 994976..995703 719..1446 100   Plus
arm_3L 994708..994916 510..718 100 -> Plus
arm_3L 994503..994640 372..509 100 -> Plus
arm_3L 994277..994429 219..371 100 -> Plus
arm_3L 993992..994210 1..218 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:29:13 Download gff for FI04445.complete
Subject Subject Range Query Range Percent Splice Strand
3L 994976..995703 719..1446 100   Plus
3L 994708..994916 510..718 100 -> Plus
3L 994503..994640 372..509 100 -> Plus
3L 994277..994429 219..371 100 -> Plus
3L 993992..994210 1..218 99 -> Plus

FI04445.pep Sequence

Translation from 68 to 1291

> FI04445.pep
MLTALRRKIRFGMQRTVLIAVLLAVGIFSYAFLNLKFCFKLMSHRSLNLM
CQKFEKHEYSGSLCEELCGSQSSFDNFQCPLNDMKTILFTAEKNGDLYAV
KLARHNDDELSWTNNKGESIYPKLEEFHEIVKLHIILAYNVTLDDNMIRA
LVNQEIADDNSQQMVSFWRLFKDNNYMMGKLFDEESIFPAVLGSCGPYYA
TEGLEIVQSNPSIMQYLASNRVQRLKHALNIMEYIFRLDEMKPEPLKMCK
MQVNRFGTASERRLKYQSAEHVYVESQLDKRLSRGVKCHAHQDCHFHSCR
GLCDEEKQSCTHIQQNNNFQIFCEHILLGGGTFQPGLLSGVRLSKALQKL
VKMCVQPPKEHQVPGRQWAPNTQLALRLYNELKQLHQAATASAGSVIPDE
GQARRGV*

FI04445.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24426-PA 395 GF24426-PA 1..395 13..407 1984 92.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14752-PA 408 GG14752-PA 1..408 1..407 2157 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14921-PA 415 GH14921-PA 1..405 1..405 1885 83.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG12038-PA 407 CG12038-PA 1..407 1..407 2148 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11435-PA 412 GI11435-PA 1..405 1..405 1891 83.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:12:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23796-PA 413 GA23796-PA 1..407 1..407 1958 88 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14371-PA 407 GM14371-PA 1..407 1..407 2193 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13588-PA 407 GD13588-PA 1..407 1..407 2189 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13631-PA 400 GJ13631-PA 1..383 13..395 1818 85.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17328-PA 423 GK17328-PA 1..392 1..392 1899 87.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21115-PA 408 GE21115-PA 1..408 1..407 2137 98 Plus

FI04445.hyp Sequence

Translation from 68 to 1291

> FI04445.hyp
MLTALRRKIRFGMQRTVLIAVLLAVGIFSYAFLNLKFCFKLMSHRSLNLM
CQKFEKHEYSGSLCEELCGSQSSFDNFQCPLNDMKTILFTAEKNGDLYAV
KLARHNDDELSWTNNKGESIYPKLEEFHEIVKLHIILAYNVTLDDNMIRA
LVNQEIADDNSQQMVSFWRLFKDNNYMMGKLFDEESIFPAVLGSCGPYYA
TEGLEIVQSNPSIMQYLASNRVQRLKHALNIMEYIFRLDEMKPEPLKMCK
MQVNRFGTASERRLKYQSAEHVYVESQLDKRLSRGVKCHAHQDCHFHSCR
GLCDEEKQSCTHIQQNNNFQIFCEHILLGGGTFQPGLLSGVRLSKALQKL
VKMCVQPPKEHQVPGRQWAPNTQLALRLYNELKQLHQAATASAGSVIPDE
GQARRGV*

FI04445.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG12038-PA 407 CG12038-PA 1..407 1..407 2148 100 Plus