Clone FI04467 Report

Search the DGRC for FI04467

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:67
Vector:pFlc-1
Associated Gene/TranscriptPdxk-RC
Protein status:FI04467.pep: gold
Sequenced Size:1570

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34455 2008-12-18 5.12 accounting

Clone Sequence Records

FI04467.complete Sequence

1570 bp assembled on 2008-11-07

GenBank Submission: BT057988.1

> FI04467.complete
GTTGGGTTCCAAGGCCGGACAAACATGACTCGTTAGTCGGAAAGACCTCC
AATCTCTTATACATTGTTTACGCCAAATGCACTCACTATTCAATTCGGTA
ATCTCCGCCTAAAGGGGTTCCACTCATCGGTTATCAGCTAGCAGTTATCA
GCCAGAGAAGCTAGCTATGAATTCCCGCTCCCTCGCTGATAACACGGTTA
TAAGCTATCTCCTCTGTGTGTGTGTGTGTGACTTGTAGACCCACCAGCTT
CATTTGCTCATTGATCGGCGGTCACTCGACGCGGAAAGTTCCACGGAAAG
AAGCAGCGAAAATGGCAGGTGCAACAAATGCGGACATCAAGCGGGTTCTA
TCCATCCAGAGCCATGTGGTCCACGGCTATGTGGGAAACAAGGTGGCCAC
CTATCCACTGCAGCTGCTGGGTTTCGATGTGGATCCACTGAACTCGGTCC
AGTTCTCCAATCATACGGGCTACAAGACCTTTAAGGGTCCCGTCTCCAAT
GAAAAGGAATTAGCCACCATTTTCGAGGGTCTGGAGGAGAACGAGCTGCT
GCCATTGTACTCACACCTCTTGACCGGCTACATTGGAAATCCATTGTTCC
TACGCCAGGTGGGCCACATTCTCAAGAAGCTGCGTCAGGCTAATCCTGGC
CTGGTGTACGTCTGTGATCCGGTTATGGGTGACAATGGTCAGCTCTATGT
GCCCAAGGAGCTCTTGCCCGTGTATCGGGACGAGATCATTCCACTAGCGG
ACATCATCACTCCCAATCAATTCGAAGTGGAGCTGCTCACGGAAAAGGAG
GTACGCAGCGAGGCGGCTGTTTGGGAGGCAATGGAGTGGTTCCATCAGCG
TGGCATCAAGACTGTGGTCATTTCCAGCAGTGATCTTGGCCAGCCTGGCG
TTCTGCGTGCTTTCCTTAGCCAGCAGAATGGTCCCCGCCTGGCCATTGAT
ATTCCGAAGCAGGGTGGCAAGGATTTGGTCTTCACTGGCACCGGCGATCT
CTTCGCCTCCCTTTTCCTGGCCCACAGTCATGGCAGCAAGGATATAGCCA
ATGTTTTCGAGAAAACCATCGCCAGTTTGCAGGCGGTGATCAAGCGAACT
GTGGCTTCGCTGCCCAACGGTGGAAACGGCCCAGTCAAAGCAGCCGAACG
GGAACTAAAGCTGGTGCAGTCCAAGACGGAAATTGAACAGCCCCAGGTGC
TCCTCAAAGCGCAGCGACTTAACTAGACCGCGGAAACTTGTTCAAACTAA
AAAGGGAAACGATTATCTTTACAATATTTTCTATACATGTATGCTCGTTG
TGCTTGTTCACGGACAATAACCTTTTGATACCTTAAGATCAGCATTTGTA
GGCATTGTTATAACGATATATGATGATTAACAGAGTGACAAGTTAAGTAC
CATATATAATTGATAAAAGGCAGAGATCAAATATATACCTATATGCTCAT
TATTCGGACAAGCTTTGATACCTTTAAGTTGAATTTTTTATATGCATTAT
TATAACTATTAACTATACAAATAGAAATATATGACCATTGTAAAACTAAA
AAACAAAAAAAAAAAAAAAA

FI04467.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG34455-RC 1673 CG34455-RC 72..1617 2..1547 7715 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 18:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9352925..9353960 512..1547 5060 99.2 Plus
chr3L 24539361 chr3L 9352276..9352687 2..413 2030 99.5 Plus
chr3L 24539361 chr3L 9352759..9352860 412..513 510 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 18:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
Pdxk-RC 915 CG34455-PC 1..915 312..1226 4575 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 18:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
Pdxk-RC 1590 CG34455-RC 45..1590 2..1547 7715 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Pdxk-PC 304 CG34455-PC 1..304 312..1223 1554 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 18:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9361007..9362042 512..1547 5180 100 Plus
3L 28110227 3L 9360360..9360771 2..413 2045 99.8 Plus
3L 28110227 3L 9360841..9360942 412..513 510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9354107..9355142 512..1547 5180 100 Plus
3L 28103327 3L 9353460..9353871 2..413 2045 99.7 Plus
3L 28103327 3L 9353941..9354042 412..513 510 100 Plus
Blast to na_te.dros performed on 2014-11-26 18:59:38 has no hits.

FI04467.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:23:01 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9352927..9353965 514..1554 98   Plus
chr3L 9352761..9352860 414..513 100 -> Plus
chr3L 9352274..9352687 1..413 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:48:06 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
CG34455-RC 1..915 312..1226 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:20:07 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
CG34455-RC 1..915 312..1226 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:25:24 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
CG34455-RC 1..915 312..1226 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:01 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
Pdxk-RC 1..915 312..1226 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:01:07 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
CG34455-RC 48..1594 1..1547 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:20:07 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
CG34455-RC 48..1594 1..1547 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:25:24 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
CG34455-RC 44..1590 1..1547 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-07 18:14:40 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
CG34455-RC 48..1594 1..1547 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:01 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
Pdxk-RC 44..1590 1..1547 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:23:01 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9361009..9362047 514..1554 99   Plus
3L 9360843..9360942 414..513 100 -> Plus
3L 9360359..9360771 1..413 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:25:24 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9354109..9355147 514..1554 99   Plus
arm_3L 9353943..9354042 414..513 100 -> Plus
arm_3L 9353459..9353871 1..413 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:51:31 Download gff for FI04467.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9354109..9355147 514..1554 99   Plus
3L 9353943..9354042 414..513 100 -> Plus
3L 9353459..9353871 1..413 99 -> Plus

FI04467.pep Sequence

Translation from 311 to 1225

> FI04467.pep
MAGATNADIKRVLSIQSHVVHGYVGNKVATYPLQLLGFDVDPLNSVQFSN
HTGYKTFKGPVSNEKELATIFEGLEENELLPLYSHLLTGYIGNPLFLRQV
GHILKKLRQANPGLVYVCDPVMGDNGQLYVPKELLPVYRDEIIPLADIIT
PNQFEVELLTEKEVRSEAAVWEAMEWFHQRGIKTVVISSSDLGQPGVLRA
FLSQQNGPRLAIDIPKQGGKDLVFTGTGDLFASLFLAHSHGSKDIANVFE
KTIASLQAVIKRTVASLPNGGNGPVKAAERELKLVQSKTEIEQPQVLLKA
QRLN*

FI04467.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10684-PA 297 GF10684-PA 3..297 10..304 1459 92.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15362-PA 304 GG15362-PA 1..304 1..304 1572 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:18:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14580-PA 304 GH14580-PA 7..304 6..304 1343 84.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
Pdxk-PC 304 CG34455-PC 1..304 1..304 1554 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13906-PA 302 GI13906-PA 2..302 5..304 1320 81.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27371-PB 217 GL27371-PB 1..130 174..304 574 84.7 Plus
Dper\GL27371-PA 302 GL27371-PA 1..129 174..303 574 85.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18188-PA 301 GA18188-PA 2..301 4..304 1386 87.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25134-PA 51 GM25134-PA 1..34 1..34 174 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14171-PA 304 GD14171-PA 1..304 1..304 1590 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11763-PA 300 GJ11763-PA 2..300 5..304 1349 85.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17630-PA 298 GK17630-PA 4..298 10..304 1357 87.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20824-PA 305 GE20824-PA 3..305 2..304 1569 98.7 Plus

FI04467.hyp Sequence

Translation from 311 to 1225

> FI04467.hyp
MAGATNADIKRVLSIQSHVVHGYVGNKVATYPLQLLGFDVDPLNSVQFSN
HTGYKTFKGPVSNEKELATIFEGLEENELLPLYSHLLTGYIGNPLFLRQV
GHILKKLRQANPGLVYVCDPVMGDNGQLYVPKELLPVYRDEIIPLADIIT
PNQFEVELLTEKEVRSEAAVWEAMEWFHQRGIKTVVISSSDLGQPGVLRA
FLSQQNGPRLAIDIPKQGGKDLVFTGTGDLFASLFLAHSHGSKDIANVFE
KTIASLQAVIKRTVASLPNGGNGPVKAAERELKLVQSKTEIEQPQVLLKA
QRLN*

FI04467.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
Pdxk-PC 304 CG34455-PC 1..304 1..304 1554 100 Plus