Clone FI04468 Report

Search the DGRC for FI04468

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:68
Vector:pFlc-1
Associated Gene/Transcriptalc-RA
Protein status:FI04468.pep: gold
Sequenced Size:1531

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
alc 2008-12-18 5.12 accounting

Clone Sequence Records

FI04468.complete Sequence

1531 bp assembled on 2008-11-06

GenBank Submission: BT050564.1

> FI04468.complete
AATTGGAACTGCGAATATACTGCCTGTGTATATATGTAAATGTTTATAAT
TAGCAATTTTTCTACGAAACAAACGATTAAATAATGCAGTTTTCTGCCTA
CTAAATGCCAAATACAACACACAGACTTCGAGCCACGAACGGTGATGTGA
TCAGAGTACTAGAGTAATCCAACGAAAAACGCGAGTCCATTTTAAAGCGA
AGTATAAAGTGCCAAACAAAGGGAGCAGTCGAACCCAGTCCAAATCCAAT
CATTATACTCGGTCCGTGACCTGCCGACGAGCCAGCGAGTACGGCAATAA
GCATGGGCAACGCCAGCTCCTCCGTGCACATGCAACGCGAGCGCCACAAG
TCGACCGACTTGTCCACGCCGAGCTCTCCCGCACATTTCCGCGATTCGAT
TGGTGGAGGAGGAGCGGGACAGGGCGGGAGTGCTGGCGCAGCAGCTCTGG
GCGCTGCAGCGGGGGCGGTGGGAGCTGCGGGGGGTGGAGGAGGAGGCGGC
GGAGGCCAAGCTTTCTCGTTCGACAAAAAACATACGGCAGTCTTGAACGA
GGGCTCGTCGCAAGAAGACGACGACCCGTACTACACGGGAACTGGAACTG
GATCCACTAGACGAGGCACCGCACACGACGACGCTACATCAGCTGTTACC
CGAGACCACTCCAGCATGGACAACAACGAGGAGGAGGAGGAGGCAGCGGT
AGGAGCGGAGCCAGCGACTGGATCTCAGTTAACCGGCGATGAGGACGACA
TCCGGAAGACGGCACTGCCCACAGTTCTGCGGTGGGACGGCGGCGGCAAG
AACGTCACCATCTCGGGCACATTCTCCGATTGGAAGCCCATGGCCATGGT
GCGCAGCCATCAGAACTTCGTGACCATCATAGATCTGCCGGAGGGCGACC
ATCAGTACAAGTTCTGCGTGGACGGCGAGTGGAAGCACGATCCCAAGCTG
AAAAGCGTGGAGAACGCCGAGGGACAGAGAAATAACTTAGTGTCCGTGCG
AGAATCCGATTTCGAGGTGTTCCAGGCCCTAGCCAAAGACAGCGAGAACG
TGACCAACTATGCGGAGAAGGAGTACTCGCAGGAGGTGCCGCAGGTGAAG
CCCTGGGAGAAGGTATCTGGCCCGCCCGTTCTGCCGCCCCATCTGCTCCA
GGTCATCCTCAACAAGGATACACCGCTATCGTGTGAACCCACTCTGCTGC
CGGAACCCAACCACGTGATGCTTAACCACTTGTACGCCCTGTCTATCAAG
GATGGCGTCATGGTCCTGAGTGCCACGCACAGGTATCGCAAGAAGTACGT
CACCACGCTGCTGTACAAGCCCATTTAGGCAACTCGCAATTGGTATTTTA
GCTGTAGGAACATGGTTTTTATGAGGGATACCACGTCCCGCTTGTCAAAT
TTACCTTATTATGAGTAAAAGTGTTTTAGTTTTCTCTCTATTAAGCGTTG
TATTTTTATTAGTTATAAATATACGGAACTTGTAAAAATATAAGATTATT
GCATTGTGTCATAAGAAAAAAAAAAAAAAAA

FI04468.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
alc-RA 1613 alc-RA 100..1613 1..1514 7555 99.9 Plus
alc.a 1567 alc.a 50..1567 1..1514 7490 99.6 Plus
Hydr1.e 1853 Hydr1.e 1773..1853 1514..1434 405 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5024521..5025470 950..1 4690 99.6 Minus
chr2R 21145070 chr2R 5022943..5023276 1514..1181 1670 100 Minus
chr2R 21145070 chr2R 5023329..5023560 1181..950 1145 99.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:29:37
Subject Length Description Subject Range Query Range Score Percent Strand
alc-RA 1026 CG8057-PA 1..1026 303..1328 5115 99.9 Plus
alc-RB 663 CG8057-PB 1..663 666..1328 3315 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:52 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
alc-RA 1544 CG8057-RA 33..1544 1..1512 7545 99.9 Plus
alc-RB 981 CG8057-RB 1..981 532..1512 4890 99.9 Plus
Hydr1-RE 1874 CG8058-RE 1794..1874 1514..1434 405 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:29:39
Subject Length Description Subject Range Query Range Score Percent Strand
alc-PA 341 CG8057-PA 1..341 303..1325 1423 100 Plus
alc-PB 220 CG8057-PB 1..220 666..1325 1094 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9136952..9137901 950..1 4735 99.9 Minus
2R 25286936 2R 9135373..9135706 1514..1181 1670 100 Minus
2R 25286936 2R 9135765..9135996 1181..950 1160 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9138151..9139100 950..1 4735 99.8 Minus
2R 25260384 2R 9136572..9136905 1514..1181 1670 100 Minus
2R 25260384 2R 9136964..9137195 1181..950 1160 100 Minus
Blast to na_te.dros performed on 2014-11-27 05:29:35 has no hits.

FI04468.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:36:15 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5024521..5025470 1..950 99   Minus
chr2R 5023329..5023559 951..1181 99 <- Minus
chr2R 5022942..5023275 1182..1515 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:48:10 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 1..1026 303..1328 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:19:31 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 1..1026 303..1328 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:39:01 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 1..1026 303..1328 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:15 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 1..1026 303..1328 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:00:24 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 50..1561 1..1512 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:19:31 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 50..1561 1..1512 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:39:01 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 33..1544 1..1512 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-06 19:04:50 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 50..1563 1..1515 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:15 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
alc-RA 33..1544 1..1512 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:36:15 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9136952..9137901 1..950 99   Minus
2R 9135765..9135995 951..1181 100 <- Minus
2R 9135372..9135705 1182..1515 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:39:01 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5024457..5025406 1..950 99   Minus
arm_2R 5023270..5023500 951..1181 100 <- Minus
arm_2R 5022877..5023210 1182..1515 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:50:52 Download gff for FI04468.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9138151..9139100 1..950 99   Minus
2R 9136964..9137194 951..1181 100 <- Minus
2R 9136571..9136904 1182..1515 99 <- Minus

FI04468.pep Sequence

Translation from 302 to 1327

> FI04468.pep
MGNASSSVHMQRERHKSTDLSTPSSPAHFRDSIGGGGAGQGGSAGAAALG
AAAGAVGAAGGGGGGGGGQAFSFDKKHTAVLNEGSSQEDDDPYYTGTGTG
STRRGTAHDDATSAVTRDHSSMDNNEEEEEAAVGAEPATGSQLTGDEDDI
RKTALPTVLRWDGGGKNVTISGTFSDWKPMAMVRSHQNFVTIIDLPEGDH
QYKFCVDGEWKHDPKLKSVENAEGQRNNLVSVRESDFEVFQALAKDSENV
TNYAEKEYSQEVPQVKPWEKVSGPPVLPPHLLQVILNKDTPLSCEPTLLP
EPNHVMLNHLYALSIKDGVMVLSATHRYRKKYVTTLLYKPI*

FI04468.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12951-PA 330 GF12951-PA 1..330 1..341 1310 77.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10580-PA 335 GG10580-PA 1..335 1..341 1507 91.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21488-PA 339 GH21488-PA 1..339 1..341 1238 76.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
alc-PA 341 CG8057-PA 1..341 1..341 1801 100 Plus
alc-PB 220 CG8057-PB 1..220 122..341 1170 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19965-PA 337 GI19965-PA 1..337 1..341 1212 74 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16847-PA 337 GL16847-PA 1..337 1..341 1265 76.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20794-PA 337 GA20794-PA 1..337 1..341 1265 76.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20628-PA 341 GM20628-PA 1..341 1..341 1800 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10101-PA 341 GD10101-PA 1..341 1..341 1803 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15118-PA 334 GJ15118-PA 1..334 1..341 1255 77.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23260-PA 341 GK23260-PA 1..341 1..341 1234 70.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22532-PA 217 GE22532-PA 1..217 122..341 1102 94.5 Plus

FI04468.hyp Sequence

Translation from 302 to 1327

> FI04468.hyp
MGNASSSVHMQRERHKSTDLSTPSSPAHFRDSIGGGGAGQGGSAGAAALG
AAAGAVGAAGGGGGGGGGQAFSFDKKHTAVLNEGSSQEDDDPYYTGTGTG
STRRGTAHDDATSAVTRDHSSMDNNEEEEEAAVGAEPATGSQLTGDEDDI
RKTALPTVLRWDGGGKNVTISGTFSDWKPMAMVRSHQNFVTIIDLPEGDH
QYKFCVDGEWKHDPKLKSVENAEGQRNNLVSVRESDFEVFQALAKDSENV
TNYAEKEYSQEVPQVKPWEKVSGPPVLPPHLLQVILNKDTPLSCEPTLLP
EPNHVMLNHLYALSIKDGVMVLSATHRYRKKYVTTLLYKPI*

FI04468.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
alc-PA 341 CG8057-PA 1..341 1..341 1801 100 Plus
alc-PB 220 CG8057-PB 1..220 122..341 1170 100 Plus