Clone FI04472 Report

Search the DGRC for FI04472

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:72
Vector:pFlc-1
Associated Gene/TranscriptCG5807-RA
Protein status:FI04472.pep: gold
Sequenced Size:2717

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5807 2008-12-18 5.12 accounting

Clone Sequence Records

FI04472.complete Sequence

2717 bp assembled on 2008-11-07

GenBank Submission: BT057989.1

> FI04472.complete
AATTGTCCACCTCTAGCAGATGCGGTCAATCTGACGCCAGTTTATAGAAA
TCTTTTAACGTTTCGGTCGTAAATCGGCTCGAATGCTAGTAGAAAATTAG
TGACCAGCGCAAAACGGGTCGAAAGGCAATGCGGCATCAAAAAGTTAACT
AAATTAATCACAATTACCGTGCGAAATCAGACAGTGCAGCGCCACAGCGA
CTTTAATTCAGAAAATTTGTAACCTGGAGCGCATTACTAAGAAGGACTGT
TGCCCATAGGAATTTGACAGACTCTGGCGACTGTCAAATGTGTATGTAAC
ATTTTTAAGTGAGGCGTGATCTAGGAAAAATTGTGAAAACTGGCTACCAG
CGATAAATTGTCCAAATATTTCGTGGGCATGGACGAAGAGGAGGAGGAGG
AGGTTACGGATCTAAAGCTGCAATTGTTCCACAATACAGTACGCGAGCAC
ATTATATTCTTGCTACTGATAATCTTGCTGTACTCCAGCTCCTATGTGGT
CGTCTCACGTTTTAGGCGGCGCGACCGTGACGATCTCTATTCGAATGACG
AGGACGAGGTGCTGGTCTATCGCATAAGCTTTTGGCTGTGCACATTCACA
CTGGCCGTTGCCGAAGGGGCTGCCATGCTGCTGCCCGTTTCCATTGCCAG
CAATGAGGTGCTACTCCTCTATCCCAACAGTTACTATGTGAAATGGCTAA
ACAGTTCACTCATACAGGGCTTGTGGAACCATGTATTTCTGTTCTCCAAT
CTGTCACTGTTCATCTTCCTGCCATTTGTCTATTTGTTCTCGGAATCCAC
GGGATTCGTCGGCAACAAGAAGGGCATCCTGCCGCGAGTCTACGAAACCT
TTACAGTATTTATGCTGATGGCCATTATTGTCCTCGTACTAACTGCCGTC
CTAAGTGCAGTCTTTGGCATTGAAAAGCTTCAATTCTTCTGGTTTCTAAA
TTTGGGCAGTGTTCACCTGCCGTTTCTTTATTCGTGTGTCTCGTTTTTGG
GTGTCATGCTTATGCTGATTTGCACCCCGTATGGCTTTGTGCGCCTCTTT
GGCGTTGTTAACCAGGTGCTGGTGCGACCTATGCTACTGCGCGACGTCAA
CGAGGAGTTTAGCGCCTTCTACATGGAGGAGGCGAGCGTGAAGCGGAAGC
TAGCGCACATTGAGCTGCACAACGTGAGCATTGCGGATGCCGCCAACGGA
GGTCGCCTTGGCAATCGGATTGGTCTGGGACGTGGGCGCACCTTCTATCC
CCAGCCACTGCTGCAACACTCCCAGGCTCATCTATACCAGCGCAAGGCGA
TGGCCAGTGACGTGGACGAGCTCAACGATAGACTAAGAGAACTGGACTCC
GAGCGCAAGGAACTAGACAAGCTGCGCACATCGAGCACCTTCCAACGCAC
ATTCGTCTATCCGCTGGCCATGCTGCTGCTGCTCTTCTGCACAGCTGTCA
CCATTCTGCTGGTTGTGCAGAATACACTAGAGCTCCTTATTGGCATTAAG
GCGCTGCCACTAAGCACAAGGCAATTCGCATTGGGCATCTCTTCGCTCTC
GAAGTTGGGTCCCTTTGGTGCCGGCCTGGAGGTGTGTCTCATCTTCTATC
TCGGCGCCACCTCGGTGGTGGGCTTCTACAGCATGCCGTTCATGCGCAAG
GTTTGTCCCAAGCGGCGCCAGACTTCGCTGCCACAGCTAATGCTGAACTG
TGGCTTCATGCTGGTTTTGTCGTCGGCATTGCCGCTTCTCAGCAGGATCA
TAGGCATCACAAACTTTGACCTGCTGGGTGATTTTGGAGCCATCGAGTGG
TTGGGAAACTTCCAGATTGTATTGCTTTACAATTTGGTTTTTGGAACCAC
AACTGCCCTGTGCTTGGCAAACAAATTCACGGCTACGGTGCGCCGGGAGC
TAAGAGCCCGGTTAGTGGAGAACTATGTGCTCTTTACTAACTACATTAGC
TTCATCAACTGATATTGGCGCAAGCGACACGACAATGCGTTTTGTATAAA
CCGACAGGAGGTGAGGCGCCTTGTCGAGTCGCCGCTAAAGAGCCTAACAA
GTTTCTATACCAAGTATCGTAACCTTAGTCGTAAGAGCAGTCGCAATACC
ACCGCTAGTCGCAAGGCAAACGAAATGAACTGTTAAGACACGAGAAAAAC
ATGGGAGATGGGCAGCTGAAACTATATAATATACCTTTACATATGTTATA
TGATCACGTATAGTTGTGCAGAACTGATACTAATATTTAAATTTTGCAAT
GTTAACTGTTGTGCTTAATTGTTGTACTTTATACAGACAGAGTCCTCACA
GTGCACCAGCATATCACTGTGGTGCCAGTAAACACAGAACAATGGCACTC
GTGTACCATGATATTCGCAGAAATCTCGCCAATAACTAGCATGTAAATAG
AAGATGTAATTGTGCAACATAAGCCGCAGTCAATTTGCAGTAGGCGTAGT
TTAGAATTTCGTTTCTTGTCGTTCAGAGTGAATTCCATTTCATACATGTT
TTTCGCTATTTATCCACGTATATTTCAGTTATTTTTATAAGATTTTAACA
ATGTTCCTTAAGCAGCGAAACGATGAGGCGTGTTCATTTCATTTTACGGC
ATACTCAAATCTGTAACCCAATATTCACACAATCACACACTAACAAGCGT
CTAAAACTTATGTGATAAAAAATAATAATAAACAAAGCATTTTACTAAAT
TAAAAAAAAAAAAAAAA

FI04472.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5807-RA 2783 CG5807-RA 41..2743 1..2703 13515 100 Plus
CG5807.a 2073 CG5807.a 23..1932 1..1910 9550 100 Plus
CG6980-RA 941 CG6980-RA 857..925 1018..950 345 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20628911..20629860 2701..1752 4750 100 Minus
chr3R 27901430 chr3R 20630217..20630719 1521..1019 2515 100 Minus
chr3R 27901430 chr3R 20636814..20637266 453..1 2265 100 Minus
chr3R 27901430 chr3R 20629924..20630157 1754..1521 1170 100 Minus
chr3R 27901430 chr3R 20632051..20632282 949..718 1160 100 Minus
chr3R 27901430 chr3R 20632341..20632483 719..577 700 99.3 Minus
chr3R 27901430 chr3R 20632598..20632722 578..454 610 99.2 Minus
chr3R 27901430 chr3R 20631833..20631901 1018..950 345 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG5807-RA 1584 CG5807-PA 1..1584 379..1962 7920 100 Plus
CG5807-RB 1560 CG5807-PB 1..1532 379..1910 7660 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:55 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG5807-RA 2690 CG5807-RA 1..2685 17..2701 13425 100 Plus
CG5807-RB 2035 CG5807-RB 1..1894 17..1910 9470 100 Plus
CG6980-RA 927 CG6980-RA 847..915 1018..950 345 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG5807-PA 527 CG5807-PA 1..527 379..1959 2281 100 Plus
CG5807-PB 519 CG5807-PB 1..518 379..1932 2208 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24805670..24806621 2703..1752 4760 100 Minus
3R 32079331 3R 24806978..24807480 1521..1019 2515 100 Minus
3R 32079331 3R 24813576..24814028 453..1 2265 100 Minus
3R 32079331 3R 24806685..24806918 1754..1521 1170 100 Minus
3R 32079331 3R 24808815..24809046 949..718 1160 100 Minus
3R 32079331 3R 24809105..24809247 719..577 715 100 Minus
3R 32079331 3R 24809362..24809486 578..454 625 100 Minus
3R 32079331 3R 24808597..24808665 1018..950 345 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24546501..24547452 2703..1752 4760 100 Minus
3R 31820162 3R 24547809..24548311 1521..1019 2515 100 Minus
3R 31820162 3R 24554407..24554859 453..1 2265 100 Minus
3R 31820162 3R 24547516..24547749 1754..1521 1170 100 Minus
3R 31820162 3R 24549646..24549877 949..718 1160 100 Minus
3R 31820162 3R 24549936..24550078 719..577 715 100 Minus
3R 31820162 3R 24550193..24550317 578..454 625 100 Minus
3R 31820162 3R 24549428..24549496 1018..950 345 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:29:15 has no hits.

FI04472.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:30:46 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20636814..20637266 1..453 100   Minus
chr3R 20632598..20632722 454..578 99 <- Minus
chr3R 20632342..20632481 579..718 99 <- Minus
chr3R 20632051..20632281 719..949 100 <- Minus
chr3R 20631833..20631901 950..1018 100 <- Minus
chr3R 20630217..20630719 1019..1521 100 <- Minus
chr3R 20629925..20630156 1522..1753 100 <- Minus
chr3R 20628911..20629858 1754..2701 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:48:12 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 1..1584 379..1962 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:20:11 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 1..1584 379..1962 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:01:53 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 1..1584 379..1962 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:30:46 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 1..1584 379..1962 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:01:12 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 1..2701 1..2701 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:20:11 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 1..2701 1..2701 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:01:53 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 1..2685 17..2701 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-07 18:45:14 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 1..2701 1..2701 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:30:46 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
CG5807-RA 1..2685 17..2701 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:30:46 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24813576..24814028 1..453 100   Minus
3R 24809362..24809486 454..578 100 <- Minus
3R 24809106..24809245 579..718 100 <- Minus
3R 24808815..24809045 719..949 100 <- Minus
3R 24808597..24808665 950..1018 100 <- Minus
3R 24806978..24807480 1019..1521 100 <- Minus
3R 24806686..24806917 1522..1753 100 <- Minus
3R 24805672..24806619 1754..2701 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:01:53 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20639298..20639750 1..453 100   Minus
arm_3R 20635084..20635208 454..578 100 <- Minus
arm_3R 20634828..20634967 579..718 100 <- Minus
arm_3R 20634537..20634767 719..949 100 <- Minus
arm_3R 20634319..20634387 950..1018 100 <- Minus
arm_3R 20632700..20633202 1019..1521 100 <- Minus
arm_3R 20632408..20632639 1522..1753 100 <- Minus
arm_3R 20631394..20632341 1754..2701 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:51:36 Download gff for FI04472.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24554407..24554859 1..453 100   Minus
3R 24550193..24550317 454..578 100 <- Minus
3R 24549937..24550076 579..718 100 <- Minus
3R 24549646..24549876 719..949 100 <- Minus
3R 24549428..24549496 950..1018 100 <- Minus
3R 24547809..24548311 1019..1521 100 <- Minus
3R 24547517..24547748 1522..1753 100 <- Minus
3R 24546503..24547450 1754..2701 100 <- Minus

FI04472.pep Sequence

Translation from 378 to 1961

> FI04472.pep
MDEEEEEEVTDLKLQLFHNTVREHIIFLLLIILLYSSSYVVVSRFRRRDR
DDLYSNDEDEVLVYRISFWLCTFTLAVAEGAAMLLPVSIASNEVLLLYPN
SYYVKWLNSSLIQGLWNHVFLFSNLSLFIFLPFVYLFSESTGFVGNKKGI
LPRVYETFTVFMLMAIIVLVLTAVLSAVFGIEKLQFFWFLNLGSVHLPFL
YSCVSFLGVMLMLICTPYGFVRLFGVVNQVLVRPMLLRDVNEEFSAFYME
EASVKRKLAHIELHNVSIADAANGGRLGNRIGLGRGRTFYPQPLLQHSQA
HLYQRKAMASDVDELNDRLRELDSERKELDKLRTSSTFQRTFVYPLAMLL
LLFCTAVTILLVVQNTLELLIGIKALPLSTRQFALGISSLSKLGPFGAGL
EVCLIFYLGATSVVGFYSMPFMRKVCPKRRQTSLPQLMLNCGFMLVLSSA
LPLLSRIIGITNFDLLGDFGAIEWLGNFQIVLLYNLVFGTTTALCLANKF
TATVRRELRARLVENYVLFTNYISFIN*

FI04472.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18773-PA 529 GF18773-PA 1..529 1..527 2406 93.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12320-PA 527 GG12320-PA 1..527 1..527 2530 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:16:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18461-PA 532 GH18461-PA 10..532 9..527 2319 91 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:16:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG5807-PA 527 CG5807-PA 1..527 1..527 2671 100 Plus
CG5807-PB 519 CG5807-PB 1..518 1..518 2598 99 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:16:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24039-PA 529 GI24039-PA 8..529 9..527 2382 92.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:16:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13860-PA 170 GL13860-PA 25..170 382..527 729 95.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:16:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19144-PA 523 GA19144-PA 2..523 3..527 2314 90.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23462-PA 527 GM23462-PA 1..527 1..527 2715 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:16:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18269-PA 527 GD18269-PA 1..527 1..527 2739 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:16:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23669-PA 622 GJ23669-PA 307..622 214..527 1439 87.7 Plus
Dvir\GJ23669-PA 622 GJ23669-PA 8..226 9..227 920 92.2 Plus
Dvir\GJ23669-PA 622 GJ23669-PA 211..258 457..504 240 93.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:16:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13167-PA 528 GK13167-PA 2..528 3..527 2280 86.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10774-PA 527 GE10774-PA 1..527 1..527 2442 97.3 Plus

FI04472.hyp Sequence

Translation from 378 to 1961

> FI04472.hyp
MDEEEEEEVTDLKLQLFHNTVREHIIFLLLIILLYSSSYVVVSRFRRRDR
DDLYSNDEDEVLVYRISFWLCTFTLAVAEGAAMLLPVSIASNEVLLLYPN
SYYVKWLNSSLIQGLWNHVFLFSNLSLFIFLPFVYLFSESTGFVGNKKGI
LPRVYETFTVFMLMAIIVLVLTAVLSAVFGIEKLQFFWFLNLGSVHLPFL
YSCVSFLGVMLMLICTPYGFVRLFGVVNQVLVRPMLLRDVNEEFSAFYME
EASVKRKLAHIELHNVSIADAANGGRLGNRIGLGRGRTFYPQPLLQHSQA
HLYQRKAMASDVDELNDRLRELDSERKELDKLRTSSTFQRTFVYPLAMLL
LLFCTAVTILLVVQNTLELLIGIKALPLSTRQFALGISSLSKLGPFGAGL
EVCLIFYLGATSVVGFYSMPFMRKVCPKRRQTSLPQLMLNCGFMLVLSSA
LPLLSRIIGITNFDLLGDFGAIEWLGNFQIVLLYNLVFGTTTALCLANKF
TATVRRELRARLVENYVLFTNYISFIN*

FI04472.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5807-PA 527 CG5807-PA 1..527 1..527 2671 100 Plus
CG5807-PB 519 CG5807-PB 1..518 1..518 2598 99 Plus