Clone FI04476 Report

Search the DGRC for FI04476

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:76
Vector:pFlc-1
Associated Gene/TranscriptCG15111-RB
Protein status:FI04476.pep: gold
Sequenced Size:1707

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15111 2008-12-18 5.12 accounting

Clone Sequence Records

FI04476.complete Sequence

1707 bp assembled on 2008-11-06

GenBank Submission: BT050565.1

> FI04476.complete
AATTGCTCCAGAAAATAGCGAAATAAACGTTTTCCAAGACCGCTTCCGAT
TCGAAAATAGGAAAAGTTGCTGGCGCGTGAGTGGTCATCATGCTTCTGGC
GTAGAGAGAAATTTTCGATCGGATTCCGTACGCTGTATTCCACCTGACGA
CCAGAGGCTCTCTTTTCAATTATGCTCTTCACGCGCCGGCGACTCCTCAA
AAGCTACGCACACAAAAACGCACAACATCAGTAACATTCAGTGTTAAGTC
GCTTTCCCCGATAGAAAGTTATATCGCTAACTATATATTAAGACGATAAA
TACAGAACGGACGTAAAACATTCACAATGTACGAGATTCATAATTGCCTA
AGGTCCGTTTTCTTAGCCACACTCATTCCCGGAACGATCCTACTTAGTTG
GCTAACTGGTCTGGTGGGTCTGCGATGTCTGCAAGCTTGTCTGCTGATCT
TCTTCCTGATCTTCGTGGTCCTACCGTTGATCTTTCGGTATTCCGTAACG
TTCCAGCGTGGCATCCTATTTCTGACATTTATTAAGTATCCCAAAGGACT
TGATCTCACCAAGCCGGAAAGCGTGGGTCTTTATGCCACACGAAACTTCT
ACATAACCGTAAAGGATCACGATCAGGACGAGGATGGAGTGCGAGTTGGT
GTGTGGCACGTGCTGCCCAGCAATGCAGTGCGTCGTTTTAAGCGCGAACT
GCGCGTGGAGGAGGAAGTGGCCCAGGACCCGGATCAGCAGCTGGATCCTG
CACCTGGCAACGAACGCGAGCTGAAGGAGCTATCGCCAGCCATACGATCT
GAATTTCCCGTCGTGCTGCCGGAAAACGAGCAGCTCTTCTATGAGCGATT
GCTGCGGATGCCCGGCGGTACTGTGGTCCTCTATCTTCATGGGAACACAG
CCAGCCGGGGCAGTGGTCACCGATCGGAGGTGTATAAGCTACTGCGAAAG
CTCAACTATCATGTGTTCTCCTTCGACTACAGAGGCTATGCCGACTCCGA
TCCCGTACCTCCGACGGAGGAAGGCGTTGTGCGCGATGCCATGATGGTTT
TTGAATACATAGCCAACACCACCTCCAATCCGATTGTGGTCTGGGGCCAT
TCCCTTGGCACCGGAGTGGCCACGCATCTGTGCGCCAAGCTAGCTAGCCT
ACGGGAAAGGGCTCCCAGGGGAGTGATCCTCGAAAGCCCGTTCACCAACA
TTCGGGACGAGATACGCATGCATCCGTTTGCCAAACTCTATAAGAATCTG
CCCTGGTTCAATTTTACCATCTCGCAACCAATGTACACCAATAGGCTGAG
ATTTGAGTCGGATGTTCATGTCTTGGAGTTCCGGCAACCCATCATGATCA
TCCATGCTGAGGACGATGTCGTGGTGCCGTTTAATCTGGGCTATCGTCTG
TATAGGATCGCATTGGATGGCAGAAGTCGAACCTCGGGACCTGTGGAGTT
CCATCGCTTTGGGGCGAGCCGAAAGTATGGACACAAATACCTCTGCCGAG
CACCGGAATTGCCGGGACTGATCCAAAAGTTTGTGGAGAACTACCGTGAC
GCCGTATACTAGGTGCGATCAACTGGATATTAATTTATGTATTAGACGAA
TATTCTAATTTAGTTTTTTACCGCAATCAAACTGACACGTTCCAAATTTT
CCGCCCTGTACAAGCAAATTAAAGCAGTCGAGGAACCCAGAAAAAAAAAA
AAAAAAA

FI04476.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG15111-RB 2088 CG15111-RB 179..1866 1..1688 8440 100 Plus
CG15111-RA 1879 CG15111-RA 382..1657 413..1688 6380 100 Plus
CG15111.a 1556 CG15111.a 250..1525 413..1688 6380 100 Plus
CG15111-RA 1879 CG15111-RA 179..381 1..203 1015 100 Plus
CG15111.a 1556 CG15111.a 54..249 1..203 885 96.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 18:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15027004..15028160 532..1688 5770 99.9 Plus
chr2R 21145070 chr2R 15026265..15026478 200..413 1070 100 Plus
chr2R 21145070 chr2R 15026822..15026950 413..541 630 99.2 Plus
chr2R 21145070 chr2R 15024946..15025032 83..169 435 100 Plus
chr2R 21145070 chr2R 15024583..15024667 1..85 425 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 18:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG15111-RB 1236 CG15111-PB 1..1236 327..1562 6180 100 Plus
CG15111-RA 1182 CG15111-PA 33..1182 413..1562 5750 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:58 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 18:59:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG15111-RB 1772 CG15111-RB 83..1770 1..1688 8440 100 Plus
CG15111-RA 1563 CG15111-RA 286..1561 413..1688 6380 100 Plus
CG15111-RA 1563 CG15111-RA 83..285 1..203 1015 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG15111-PB 411 CG15111-PB 1..411 327..1559 2081 100 Plus
CG15111-PA 393 CG15111-PA 12..393 414..1559 1929 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 18:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19139876..19141032 532..1688 5785 100 Plus
2R 25286936 2R 19139137..19139350 200..413 1070 100 Plus
2R 25286936 2R 19139694..19139822 413..541 630 99.2 Plus
2R 25286936 2R 19137817..19137903 83..169 435 100 Plus
2R 25286936 2R 19137454..19137538 1..85 425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19141075..19142231 532..1688 5785 100 Plus
2R 25260384 2R 19140336..19140549 200..413 1070 100 Plus
2R 25260384 2R 19140893..19141021 413..541 630 99.2 Plus
2R 25260384 2R 19139016..19139102 83..169 435 100 Plus
2R 25260384 2R 19138653..19138737 1..85 425 100 Plus
2R 25260384 2R 19139420..19139460 163..203 175 95.1 Plus
Blast to na_te.dros performed on 2014-11-26 18:59:12 has no hits.

FI04476.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:22:55 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15027004..15028161 532..1690 99   Plus
chr2R 15026822..15026940 413..531 100 -> Plus
chr2R 15026269..15026477 204..412 100 -> Plus
chr2R 15025357..15025390 170..203 100 -> Plus
chr2R 15024947..15025032 84..169 100 -> Plus
chr2R 15024583..15024665 1..83 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:48:16 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 1..1236 327..1562 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:19:30 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 1..1236 327..1562 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:25:17 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 1..1236 327..1562 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:22:55 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 1..1236 327..1562 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:00:22 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 78..1766 1..1690 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:19:30 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 78..1766 1..1690 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:25:17 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 83..1771 1..1690 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-06 18:59:55 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 78..1766 1..1690 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:22:55 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
CG15111-RB 83..1771 1..1690 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:22:55 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19139876..19141033 532..1690 99   Plus
2R 19139694..19139812 413..531 100 -> Plus
2R 19139141..19139349 204..412 100 -> Plus
2R 19138228..19138261 170..203 100 -> Plus
2R 19137818..19137903 84..169 100 -> Plus
2R 19137454..19137536 1..83 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:25:17 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15027381..15028538 532..1690 99   Plus
arm_2R 15027199..15027317 413..531 100 -> Plus
arm_2R 15026646..15026854 204..412 100 -> Plus
arm_2R 15025733..15025766 170..203 100 -> Plus
arm_2R 15025323..15025408 84..169 100 -> Plus
arm_2R 15024959..15025041 1..83 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:50:51 Download gff for FI04476.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19141075..19142232 532..1690 99   Plus
2R 19140893..19141011 413..531 100 -> Plus
2R 19140340..19140548 204..412 100 -> Plus
2R 19139427..19139460 170..203 100 -> Plus
2R 19139017..19139102 84..169 100 -> Plus
2R 19138653..19138735 1..83 100 -> Plus

FI04476.pep Sequence

Translation from 326 to 1561

> FI04476.pep
MYEIHNCLRSVFLATLIPGTILLSWLTGLVGLRCLQACLLIFFLIFVVLP
LIFRYSVTFQRGILFLTFIKYPKGLDLTKPESVGLYATRNFYITVKDHDQ
DEDGVRVGVWHVLPSNAVRRFKRELRVEEEVAQDPDQQLDPAPGNERELK
ELSPAIRSEFPVVLPENEQLFYERLLRMPGGTVVLYLHGNTASRGSGHRS
EVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIANTTS
NPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHP
FAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVV
PFNLGYRLYRIALDGRSRTSGPVEFHRFGASRKYGHKYLCRAPELPGLIQ
KFVENYRDAVY*

FI04476.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11491-PA 453 GF11491-PA 1..409 1..410 1814 81.8 Plus
Dana\GF11574-PA 253 GF11574-PA 8..251 160..403 644 44.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21946-PA 411 GG21946-PA 1..411 1..411 2135 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:22:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22637-PA 424 GH22637-PA 1..424 1..411 1631 72.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG15111-PB 411 CG15111-PB 1..411 1..411 2167 100 Plus
CG15111-PA 393 CG15111-PA 12..393 30..411 2015 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18913-PA 415 GI18913-PA 1..415 1..411 1616 75.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11873-PA 405 GL11873-PA 1..392 1..397 1484 70.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:22:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13500-PA 411 GA13500-PA 1..411 1..411 1694 76.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21934-PA 411 GM21934-PA 1..411 1..411 2165 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11430-PA 411 GD11430-PA 1..411 1..411 2167 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19768-PA 419 GJ19768-PA 1..419 1..411 1673 76.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17965-PA 421 GK17965-PA 1..421 1..411 1712 78.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12020-PA 411 GE12020-PA 1..411 1..411 2142 98.1 Plus

FI04476.hyp Sequence

Translation from 326 to 1561

> FI04476.hyp
MYEIHNCLRSVFLATLIPGTILLSWLTGLVGLRCLQACLLIFFLIFVVLP
LIFRYSVTFQRGILFLTFIKYPKGLDLTKPESVGLYATRNFYITVKDHDQ
DEDGVRVGVWHVLPSNAVRRFKRELRVEEEVAQDPDQQLDPAPGNERELK
ELSPAIRSEFPVVLPENEQLFYERLLRMPGGTVVLYLHGNTASRGSGHRS
EVYKLLRKLNYHVFSFDYRGYADSDPVPPTEEGVVRDAMMVFEYIANTTS
NPIVVWGHSLGTGVATHLCAKLASLRERAPRGVILESPFTNIRDEIRMHP
FAKLYKNLPWFNFTISQPMYTNRLRFESDVHVLEFRQPIMIIHAEDDVVV
PFNLGYRLYRIALDGRSRTSGPVEFHRFGASRKYGHKYLCRAPELPGLIQ
KFVENYRDAVY*

FI04476.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG15111-PB 411 CG15111-PB 1..411 1..411 2167 100 Plus
CG15111-PA 393 CG15111-PA 12..393 30..411 2015 100 Plus