Clone FI04477 Report

Search the DGRC for FI04477

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:44
Well:77
Vector:pFlc-1
Associated Gene/Transcriptwun2-RA
Protein status:FI04477.pep: gold
Sequenced Size:1982

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
wun2 2008-12-18 5.12 accounting

Clone Sequence Records

FI04477.complete Sequence

1982 bp assembled on 2008-11-04

GenBank Submission: BT050465.1

> FI04477.complete
ACTTCTTCGTTCGACGTCGAACGGTGCGGACGGTCGATCGTCGTCGGGTT
GGGCAACCGTTTTCTTTCGGTTTCATTCGTCTGCCGTTTTCGTGGCGGCG
CTGCGCATGCGAAACAAATAGAAAAGCAGAACCAAGTGCGAAAAGAACTA
GACCAAGAACGAAAATACCTTCGAAGTGACAAAACGAATGCAAACAAACA
GCCATAAAGTGCAGCGGGAAAATGCAGTCCAAATAAGTGCACAGATTCTT
ACCTCGCATTATTTACCTTTGTGCGTCGCCAGCAGTATTCAGTATTTGAG
CAGCATTTCGACTCGGACTTAGTCGATCGCTATTCACGATCGCTCATCGC
TTATCGCATGCACAATAGCATTTTTCGTTCCCGTACACCTTTGCGTTTAC
CTTACCCAATTTCGTACCGCCCACAAAACGCCGACGCCGCGGCCTCTTAC
CACCACAGTATCGATTTGAGAGCTCTATTTAAATACCTGCAGCCTTATCG
CCGTGCCGCGCAAGAGGCAGCGCCCATTAGCACATTCTGAAGAGGAAAGG
CACTCCCGAGGATTATTCAAACAATTCGTTTGTGTGTCTCCGTCTCCGCC
CGATGATAAGATGACCACCGTCGTGGCGTCCAGGTGCAATAGTGCCATTC
ATTGAAGCCAGACTCCTTGGGCACCATCAGATTAGAAACCACGAAGATTC
CCCATTTCCCCCACACGATGAGCACCCTGCGACCCGTCAGCGTTTGCGAT
ACCACGCCGCTCCAGAGATTCGAGAGCCAGAGCAGCAGCGGTGAAGAGCC
TTCTTCGCCGACGGCTTCCAGTATTATAGCCGCCGCTTCAGGCCCCAATC
ACAACAACAACAACAATGTGAAACTTGACCTGCAGCTGCCCACCTTCGTT
GATAGCACCCGTAGCCAGGGTTCACTGTACGCGGTAGCCAGCAACAAGAA
GCCACCGCTGCGTGGACCACGACAAATCTTCGGAAGGATCCTCACGGACC
TCTGTTTGCTCAGCTGCGTTGGTCTACCTATGCTGGGATTTTCGCTTTGG
GGCGAAGCGGTTAAGCGCGGATTCTTCTGCGATGATTCCTCCTTGAGGCA
TCCATATCGAGACTCCACCATGCCCAGTTGGATTCTCTACTTGATGTGTG
GCGCCTTGCCTCTTACTGTGATGCTTGTGGTGGAGTTCTTTAGAGGACAG
GACAAGCGATTGCACAGTCCATTTCCGAAGAGCACGATGTGCAGTGGCTA
TCATCTGTGCCACTTGGAGCTGCCCACTTGGCTGGTGGAGTGCTACCACA
GGATGGGTATCTTTATCTTCGGATTGGGCGTAGAGCAGCTATCCACGAAC
ATCGCCAAGTATTCCATTGGACGGCTGAGACCTCACTTCTACACACTCTG
TCAGCCCGTCATGAAAGATGGCACCACTTGCAGTGATCCCATTAACGCTG
CTCGTTACATCGAGGAGTTCACCTGTGCGGCGGTGGACATTACATCGAAG
CAGCTAAAGGACATGCGCCTGTCCTTTCCCAGTGGACATGCTAGCTTCGC
CTGCTACTCCATGCTCTACTTGGTGATTTACCTACATCGTAGAATGCAAT
GGAAGCAGTTGAGAATGCTGTGCCACCTGCTTCAGTTCCTGCTGCTCATG
TTCGCCTGGTATACGGCTCTCACCAGAGTTTCCGACTACAAGCACCATTG
GTCCGATGTCTTGGCAGGATCTGGCATCGGACTGACCTACGCAGTCGTCG
TGACATCGACTATGTGGTAGGCTGGATCCTTGACTTTTCGCGGGTTCCAA
ACCCCATCAACCCACCGCGTGGAGCTGCTTTCGCTTTAAGATGTCTTATC
TGGCGCAATTTCAGTTTTATCATTGTTTTAATTTGACCATGTCTGCATAG
GAGTATCTATTTATCTATGTGTGAAGGATTTTACTTAATAAACTTCAGTT
CAATGTGTTTTACCATAAAAAAAAAAAAAAAA

FI04477.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
wun2-RA 2086 wun2-RA 81..2050 1..1970 9820 99.8 Plus
wun2.b 1965 wun2.b 1..1963 1..1966 9745 99.7 Plus
wun2.c 1965 wun2.c 1..1963 1..1966 9745 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5301839..5302856 1..1018 5090 100 Plus
chr2R 21145070 chr2R 5304352..5304577 1170..1395 1115 99.6 Plus
chr2R 21145070 chr2R 5305127..5305341 1752..1966 1075 100 Plus
chr2R 21145070 chr2R 5304889..5305066 1575..1752 890 100 Plus
chr2R 21145070 chr2R 5304651..5304830 1396..1575 870 98.9 Plus
chr2R 21145070 chr2R 5304139..5304291 1018..1170 765 100 Plus
chr2R 21145070 chr2R 5289928..5290033 1721..1616 200 79.2 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
wun2-RA 1053 CG8805-PA 1..1053 718..1770 5250 99.9 Plus
wun2-RB 741 CG8805-PB 1..741 1030..1770 3690 99.9 Plus
wun-RC 1095 CG8804-PC 890..995 1616..1721 200 79.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:12:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
wun2-RA 1968 CG8805-RA 3..1968 1..1966 9815 99.9 Plus
wun2-RB 2211 CG8805-RB 3..1020 1..1018 5090 100 Plus
wun2-RB 2211 CG8805-RB 1263..2211 1018..1966 4730 99.9 Plus
wun-RC 1563 CG8804-RC 1272..1377 1616..1721 200 79.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
wun2-PA 350 CG8805-PA 1..350 718..1767 1618 100 Plus
wun2-PB 246 CG8805-PB 1..246 1030..1767 1264 100 Plus
wun-PA 300 CG8804-PA 5..265 970..1758 706 52.9 Plus
wun-PC 364 CG8804-PC 84..343 970..1755 706 53.1 Plus
wun-PB 379 CG8804-PB 84..344 970..1758 706 52.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9414344..9415361 1..1018 5090 100 Plus
2R 25286936 2R 9416857..9417082 1170..1395 1115 99.6 Plus
2R 25286936 2R 9417632..9417850 1752..1970 1080 99.5 Plus
2R 25286936 2R 9417156..9417335 1396..1575 900 100 Plus
2R 25286936 2R 9417394..9417571 1575..1752 890 100 Plus
2R 25286936 2R 9416644..9416796 1018..1170 765 100 Plus
2R 25286936 2R 9402440..9402545 1721..1616 200 79.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9415543..9416560 1..1018 5090 100 Plus
2R 25260384 2R 9418056..9418281 1170..1395 1115 99.5 Plus
2R 25260384 2R 9418831..9419049 1752..1970 1080 99.5 Plus
2R 25260384 2R 9418355..9418534 1396..1575 900 100 Plus
2R 25260384 2R 9418593..9418770 1575..1752 890 100 Plus
2R 25260384 2R 9417843..9417995 1018..1170 765 100 Plus
2R 25260384 2R 9403639..9403744 1721..1616 200 79.2 Minus
Blast to na_te.dros performed on 2014-11-26 20:13:12 has no hits.

FI04477.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:23:53 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5305128..5305341 1753..1966 100   Plus
chr2R 5304890..5305066 1576..1752 100 -> Plus
chr2R 5304651..5304830 1396..1575 98 -> Plus
chr2R 5304353..5304577 1171..1395 99 -> Plus
chr2R 5304140..5304291 1019..1170 100 -> Plus
chr2R 5301839..5302856 1..1018 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:48:17 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 1..1053 718..1770 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:18:02 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 1..1053 718..1770 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:59:33 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 1..1053 718..1770 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:53 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 1..1053 718..1770 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:14 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 1..1966 1..1966 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:18:02 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 1..1966 1..1966 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:59:33 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 3..1968 1..1966 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 12:33:08 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 1..1966 1..1966 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:53 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
wun2-RA 3..1968 1..1966 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:23:53 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9417633..9417846 1753..1966 100   Plus
2R 9417395..9417571 1576..1752 100 -> Plus
2R 9417156..9417335 1396..1575 100 -> Plus
2R 9416858..9417082 1171..1395 99 -> Plus
2R 9416645..9416796 1019..1170 100 -> Plus
2R 9414344..9415361 1..1018 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:59:33 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5305138..5305351 1753..1966 100   Plus
arm_2R 5304900..5305076 1576..1752 100 -> Plus
arm_2R 5304661..5304840 1396..1575 100 -> Plus
arm_2R 5304363..5304587 1171..1395 99 -> Plus
arm_2R 5304150..5304301 1019..1170 100 -> Plus
arm_2R 5301849..5302866 1..1018 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:13 Download gff for FI04477.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9418832..9419045 1753..1966 100   Plus
2R 9418594..9418770 1576..1752 100 -> Plus
2R 9418355..9418534 1396..1575 100 -> Plus
2R 9418057..9418281 1171..1395 99 -> Plus
2R 9417844..9417995 1019..1170 100 -> Plus
2R 9415543..9416560 1..1018 100 -> Plus

FI04477.pep Sequence

Translation from 717 to 1769

> FI04477.pep
MSTLRPVSVCDTTPLQRFESQSSSGEEPSSPTASSIIAAASGPNHNNNNN
VKLDLQLPTFVDSTRSQGSLYAVASNKKPPLRGPRQIFGRILTDLCLLSC
VGLPMLGFSLWGEAVKRGFFCDDSSLRHPYRDSTMPSWILYLMCGALPLT
VMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHRMGIFI
FGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEE
FTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRM
LCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVVVTSTMW
*

FI04477.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11822-PA 347 GF11822-PA 1..347 1..350 1200 72.5 Plus
Dana\GF13080-PA 377 GF13080-PA 6..339 8..347 794 47.5 Plus
Dana\GF10980-PA 345 GF10980-PA 62..285 113..344 538 43.1 Plus
Dana\GF10978-PA 335 GF10978-PA 35..242 116..342 476 41.4 Plus
Dana\GF10943-PA 493 GF10943-PA 89..197 227..346 434 69.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23436-PA 351 GG23436-PA 1..351 1..350 1524 90 Plus
Dere\GG10557-PA 372 GG10557-PA 6..337 8..347 828 46.9 Plus
Dere\GG16256-PA 341 GG16256-PA 9..256 90..342 508 39.8 Plus
Dere\GG16258-PA 340 GG16258-PA 50..283 103..344 484 41.3 Plus
Dere\GG13182-PA 337 GG13182-PA 5..218 116..347 443 41.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20575-PA 365 GH20575-PA 1..365 1..347 1095 63.3 Plus
Dgri\GH21309-PA 380 GH21309-PA 6..345 8..347 756 44 Plus
Dgri\GH16694-PA 345 GH16694-PA 36..287 85..344 575 41.2 Plus
Dgri\GH16692-PA 348 GH16692-PA 35..252 116..342 517 44.5 Plus
Dgri\GH14815-PA 385 GH14815-PA 5..216 116..344 444 42 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
wun2-PA 350 CG8805-PA 1..350 1..350 1876 100 Plus
wun2-PB 246 CG8805-PB 1..246 105..350 1343 100 Plus
wun-PC 364 CG8804-PC 13..343 8..346 799 45.7 Plus
wun-PB 379 CG8804-PB 13..344 8..347 799 45.6 Plus
wun-PA 300 CG8804-PA 5..265 85..347 755 52.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19768-PA 375 GI19768-PA 1..375 1..350 971 55.6 Plus
Dmoj\GI19743-PA 298 GI19743-PA 5..263 85..347 765 51 Plus
Dmoj\GI11383-PA 345 GI11383-PA 37..288 85..344 555 43.1 Plus
Dmoj\GI11380-PA 340 GI11380-PA 35..253 116..342 501 42.7 Plus
Dmoj\GI13921-PA 361 GI13921-PA 5..215 116..344 464 42.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17588-PA 372 GL17588-PA 1..372 1..350 1189 67.2 Plus
Dper\GL16886-PA 306 GL16886-PA 5..265 85..347 755 52.5 Plus
Dper\GL23165-PA 343 GL23165-PA 32..283 85..344 530 42.3 Plus
Dper\GL23143-PA 328 GL23143-PA 8..239 89..342 435 36.1 Plus
Dper\GL23154-PA 307 GL23154-PA 8..255 86..331 334 33.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24835-PA 369 GA24835-PA 1..369 1..350 1194 68 Plus
Dpse\GA21332-PA 386 GA21332-PA 6..345 8..347 764 45.4 Plus
Dpse\GA21332-PB 365 GA21332-PB 6..344 8..346 757 45.5 Plus
Dpse\GA21332-PC 306 GA21332-PC 5..265 85..347 755 52.5 Plus
Dpse\GA10999-PA 343 GA10999-PA 32..283 85..344 530 42.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21120-PA 350 GM21120-PA 1..350 1..350 1604 95.4 Plus
Dsec\GM20603-PA 372 GM20603-PA 6..337 8..347 794 45.3 Plus
Dsec\GM22448-PA 340 GM22448-PA 50..283 103..344 548 41.7 Plus
Dsec\GM22445-PA 341 GM22445-PA 9..254 90..342 510 40.6 Plus
Dsec\GM22093-PA 337 GM22093-PA 5..218 116..347 444 41.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10653-PA 350 GD10653-PA 1..350 1..350 1579 95.4 Plus
Dsim\GD10076-PA 372 GD10076-PA 6..337 8..347 803 45.9 Plus
Dsim\GD15031-PA 340 GD15031-PA 50..283 103..344 552 42.1 Plus
Dsim\GD15029-PA 341 GD15029-PA 31..254 112..342 509 42.7 Plus
Dsim\GD12067-PA 343 GD12067-PA 5..218 116..347 443 41.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18273-PA 332 GJ18273-PA 1..312 1..345 1017 59.4 Plus
Dvir\GJ18026-PA 378 GJ18026-PA 6..343 8..347 796 44 Plus
Dvir\GJ11638-PA 337 GJ11638-PA 28..279 85..344 594 42.7 Plus
Dvir\GJ11635-PA 345 GJ11635-PA 35..257 116..342 515 44.2 Plus
Dvir\GJ13711-PA 340 GJ13711-PA 5..215 116..344 453 41.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21557-PA 361 GK21557-PA 1..361 1..350 1186 67.6 Plus
Dwil\GK21745-PA 385 GK21745-PA 1..351 1..347 780 44.2 Plus
Dwil\GK16761-PA 362 GK16761-PA 47..300 83..344 544 41.2 Plus
Dwil\GK16759-PA 364 GK16759-PA 8..265 89..342 495 38.8 Plus
Dwil\GK17452-PA 349 GK17452-PA 5..215 116..344 467 41.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19275-PA 354 GE19275-PA 1..354 1..350 1563 92.7 Plus
Dyak\GE22302-PA 369 GE22302-PA 6..334 8..347 796 47.1 Plus
Dyak\GE23017-PA 341 GE23017-PA 7..254 88..342 505 39.2 Plus
Dyak\GE19506-PA 340 GE19506-PA 19..283 69..344 494 38 Plus
Dyak\GE23019-PA 340 GE23019-PA 19..283 69..344 494 38 Plus

FI04477.hyp Sequence

Translation from 717 to 1769

> FI04477.hyp
MSTLRPVSVCDTTPLQRFESQSSSGEEPSSPTASSIIAAASGPNHNNNNN
VKLDLQLPTFVDSTRSQGSLYAVASNKKPPLRGPRQIFGRILTDLCLLSC
VGLPMLGFSLWGEAVKRGFFCDDSSLRHPYRDSTMPSWILYLMCGALPLT
VMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHRMGIFI
FGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEE
FTCAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRMQWKQLRM
LCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVVVTSTMW
*

FI04477.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
wun2-PA 350 CG8805-PA 1..350 1..350 1876 100 Plus
wun2-PB 246 CG8805-PB 1..246 105..350 1343 100 Plus
wun-PC 364 CG8804-PC 13..343 8..346 799 45.7 Plus
wun-PB 379 CG8804-PB 13..344 8..347 799 45.6 Plus
wun-PA 300 CG8804-PA 5..265 85..347 755 52.9 Plus