Clone FI04515 Report

Search the DGRC for FI04515

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:45
Well:15
Vector:pFlc-1
Associated Gene/TranscriptCRMP-RC
Protein status:FI04515.pep: wuzgold
Sequenced Size:4032

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CRMP 2008-12-18 5.12 accounting

Clone Sequence Records

FI04515.complete Sequence

4032 bp assembled on 2008-10-12

GenBank Submission: BT046136.1

> FI04515.complete
ACTACGCGAGTTCCAATCGGACCGAGAGTTAAATGTTTTCCGATTTTCAA
ACAGCGAACTTGTGCGTGCGTTAAAATTAAACTCGTTCAGCATTTAAATC
GTGTGAGATCTTTGCCTTTTAACGACTATTGCCATGTCGACCAGCCCGAA
ACCGGTTAAGAAGGTGCCGATTCACTTGCAGAGTGCCCAGAATCGCGTCT
ACATCAAGAATGGCGAGATCGTCAACCATGACAAGTCCTTCAAAGCGGAC
GTGTACATCGAAGATGGAATTATCAAGTTTGTGGGTCCCTCCTCGGAAAT
AACGATACCTGGCGGAGTGCGCACCATCGACGCCAGCGGACTGATGATCA
TTCCCGGAGGCATCGATCCCCACACCCACATGCAGTTGCCTTTCGGCGGA
GCCGTGGCCGTCGACGATTTCTACCATGGAACCAAGGCCGCCGTGGCAGG
TGGCACCACCATGATCATCGACTTCGTTCTGCCCAACAAACATGAGTCGA
TGATCGAGGCCTACGACAAGTGGCGCAGCTGGGCCGATCCTAAGGTATGC
TGCGACTACGGATTGCATGTGGGCATCACCTGGTGGTCGAAGTCGGTGTC
TGAGGAGATCGGCATTCTGTGCAAAGAGCTTGGAGTGAACTCCTTCAAAA
CATTCATGGCCTACAAAGGACTTTATCAGTTGAATGACTCAGACCTTCTG
GATGTGTTCGAGCGTATCAGGCACCTAAATGGGGTTGCTATGGTCCACGC
GGAGAATGGCGACATCATTGCAAAGAACACGCAGCGCCTTTTGGCCGAGG
GCATCAATGGTCCGGAGGGTCACGAGCTGTCGCGGCCCGAGGAGGTCGAG
GCCGAGGCGGTGCACCGCGCCTGCGTCCTGGCCCACCAGGTAAGACCACT
CCCATGTCGCCAGACAGTGGGGGATGGATGGGAAGAGGGAGGAAGGAGGA
GGCGGAGTGTGTCCATGCCGGTTGAGTGCCATTGTGCACTGTGCCGCGCA
CTGTAATCATGGTTTATTTATTTATGTATGTTATTTATGATTTTGATTTC
CTATTATTTCCATTGTGTATGATGCACCCTGTACATATTATGCGGTATGC
GGCACTCGATATAACCCCACGAAAAAAACATAACCTAGGCCGATTGTCCC
CTGTACGTGGTCCACGTGATGAGCAAGTCGGCAGGCATTGAGCTGGCCAG
GGCACGCCACCGCTACCGCGGGCGATACATAATGGGCGAGACCCTGGCCG
CGGCCCTGGGCACGGATGCCACCTGTTGCCAGCACTTGGGCTTCGACGCC
GAGGCTGCGCATGTGCTCAGCCCGCCCTTGCGGCCCGACAAGACGACCCC
CGAGTTCTTGATGAAGCTGCTGGCGAAGTAAGTTCTGCCTGTTGCCTGGG
TTCACATTCCGGGCCGGGACCGTAAATGTCAGAGGGAACCATTGTTCCGC
AAATTATTCGAGAATGTTGGAAGGCACATTCTTGTATGTTAGTTGATCGT
CGCAGAAAGCTACAGGAGTATTTAAAATATATTTATTTATTTTTCAAGTA
TGGCAAGAAATAATTTAAATTTCATAAATAATGATTTTTAACTGGTAGCA
TAGAAATGCTGGCTTTATAAATGGACATTGGATCGGATTGGCATTACCAT
TTCGCCCATATTATATTACATTTAAAATTATAATCATAAAAATATTATGA
TTTAAAATTATATGTTGATATCTAAGGTTTAAAGCAATCTAAACAATTTT
TTCATGTAAACTGAGTAGGTAATTAATAATATGATTTTAAATGTATAAAT
GATTACGGTCTCTGGTCCTGGAATAACTTGTCCTTGTTGATACTGGTTAC
TCTGAATACTAACCAGGTCATTGCTTTTGCCTGCCTCAATCGTATCCACT
AACTTTCTAACTGCGCTTGTTCTCGAAACTAACCCATTGATCCAACGACG
TTTCCATGTTTGCCATTGCTTCACTCACACGCCCACCCACACGTCCAGAT
GAAGACGCCGCTCTTCGTGTCCGGCCTCACCAGCAAATCCTCCGCCGAGC
TCGTGGGTCGCGCCCGTCGCAGTGGCTACTGCGTGTTCGGGGAGACGCTG
GCCAGCTCACTGGGCCGCTCCATGAGCGCCGTGCCCAAGGGCGACCGCAT
CTACGCCATCACCAGTCCCCCGATCCGCGAATCCGCCGAGACACCCAGGC
AGCTGATGAAGTCCCTGGCTTAGTAAGTATCGCCTTGTTTTAGTGGAATC
GAAGACCCCGTACTTTGGCCGATGCCAAATATTAGTAAAGAATGCTAAAA
TGCATAGGTTTTAAACGAGGTTTGCTTAAAACAAATCTAAAGAATTAGAA
TAAAGAATACTATTTTTATAAATATATCAGACGCACAATAAGTTCATAGA
TTCCAATTGACCAGGATACCAGAAGTAAGTATCCACGATTCAGAACACGA
TCGCTGCATTCCCCACCCTGCCGGTGATTGTTTGTTTCGTTACTCTTAAC
TGACCATCTAAAAAGGTTACCATGATTCCATCATTGATCCACATTTTGTC
CACAGTGACGATTTGCAGCTGACTGGCAGCGACAATTGCACCTTCAACAA
GGAGCACAAGGCGCTCGGAAAGGGTGACTTTACCAAGATTCCCAATGGCG
TCAACGGAGTCGAGGATCGCATGTCGCTGGTCTGGGAGAAGGGCGTGCAC
GCTGGGCTTCTGGATCCTGCCGCTTTGTGGCCGTGACCAGTACAAATGCA
GCCAAGATATTCAACATCTACCCCCAGAAGGGACGCATTGCCGTCGGCTC
GGATGCGGACATTGTGATCTGGAATCCGAATGCCACCCGTACCATTTCTA
AGGATACCCACCACCATGCCTGTGACTTCAACATATTCGAGGGCATGACT
GTGCACGGCGTCTGCGAATTCGTCCTGGTGCGCGGACGGATCTGCGCCGA
GCGCGGGAATGTGCGGGTAGCGGAGGGCTTTGGACGTTTCATTCCCACAC
CAGTTCGTCCGCCGTTCGTATACGACATCATCGAGGGCAAGGTGCAGTCG
CAGCCGGAGGAGCAGCACGAGGAGAAGCAGAACGGCAGCATGGCCAAGCG
GTTCGCTGAGCTGGACATACAGATTCCGGTGCAGGAGCCCATCAGCGCCA
TGCTGGCTGGCAACCTAGCCATGCCGGCGGAGGGATCTCTGTGCAGCACG
CCCTCGGTTCGTGGTCGCGTCGATGGAAAACGCGACTTGCAGGAGTCTTC
CTTCTCCATAAGTGAGGAGCTCGACAGGTCTGGTGTTCGAGCGTGCATCA
AAGTGAAGAACCCACCTGGCGGAAAGTCTTCTGGATTCTGGTAGATCACA
GACCCGATGTCGCATCGCAAGTCGTGTGGATGCGGAATCGCACAATCTCC
GACGACAGTGTAAGCCAAAGTCTGCGCTCATTCGACAACTAAACTGGCAT
TTAATATAGATCCCTGAAACAAAATCGTAATCTAATCAAATTTCAAATAA
GTACATAAGAGCATAACCACAAACCAATTAAGAAGGTATCATAGACTCTG
CTTCGTCATTTTGTATTTAGAACCGATTGCCTCTTGTTGATACAATTTTT
GTTAAGATCATCAATTGAATGAAATGCATCAAAGCATTTGAAGTCGAAAA
TCAAACATTATGGCTGCTTAGGTATTTTTCGCTGAAATCGTTTATTTTAA
TACTTTGTTTATTTACAAGGAGATTTAGCACAATTTAACTCTGTTAAATT
CATGACACTATTGCAATTGTTTATTGATTACCCGATTCGAAGTAGAGCAC
ATCGATCATGCCACGTGAGACAAAGAGTGCTTGGGAGCAAATTCGGCATT
TAATCTGAGGATGTCTAAAAGTAATACTTCAATCGATTTTTTGATAAGAA
AAAAGTATAAATGTGGAAAACTATTTATTATAAATATACATACTTTATAT
ACATATAATATTTAACAACAAAAGCCGAACACAAAGATCAAACTAATAAA
CTTTACCAAAAGATAGAAAAAAAAAAAAAAAA

FI04515.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
CRMP-RC 4103 CRMP-RC 23..4039 4..4018 19990 99.9 Plus
CRMP-RB 2899 CRMP-RB 1372..2835 2556..4018 7280 99.9 Plus
CRMP-RE 2675 CRMP-RE 1148..2611 2556..4018 7280 99.9 Plus
CRMP-RB 2899 CRMP-RB 23..909 4..890 4435 100 Plus
CRMP-RE 2675 CRMP-RE 23..909 4..890 4435 100 Plus
CRMP-RB 2899 CRMP-RB 907..1147 1137..1377 1190 99.5 Plus
CRMP-RE 2675 CRMP-RE 907..1147 1137..1377 1190 99.5 Plus
CRMP-RB 2899 CRMP-RB 1148..1371 1999..2222 1120 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1401437..1403487 742..2790 10140 99.9 Plus
chr3R 27901430 chr3R 1404096..1404848 3264..4016 3765 100 Plus
chr3R 27901430 chr3R 1403555..1404029 2790..3264 2375 100 Plus
chr3R 27901430 chr3R 1400322..1400512 277..467 955 100 Plus
chr3R 27901430 chr3R 1400898..1401034 543..679 685 100 Plus
chr3R 27901430 chr3R 1396770..1396890 4..124 605 100 Plus
chr3R 27901430 chr3R 1399911..1400000 124..213 450 100 Plus
chr3R 27901430 chr3R 1400572..1400650 468..546 395 100 Plus
chr3R 27901430 chr3R 1400061..1400127 212..278 335 100 Plus
chr3R 27901430 chr3R 1401093..1401159 678..744 335 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
CRMP-RE 1785 CG1411-PE 996..1785 2556..3344 3900 99.9 Plus
CRMP-RA 1770 CG1411-PA 981..1770 2556..3344 3900 99.9 Plus
CRMP-RE 1785 CG1411-PE 1..757 134..890 3785 100 Plus
CRMP-RB 999 CG1411-PB 1..757 134..890 3785 100 Plus
CRMP-RA 1770 CG1411-PA 1..756 134..889 3780 100 Plus
CRMP-RE 1785 CG1411-PE 755..995 1137..1377 1190 99.6 Plus
CRMP-RA 1770 CG1411-PA 753..980 1995..2222 1140 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:13 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
CRMP-RE 2590 CG1411-RE 1129..2590 2556..4016 7260 99.9 Plus
CRMP-RB 2814 CG1411-RB 1353..2814 2556..4016 7260 99.9 Plus
CRMP-RA 2575 CG1411-RA 1114..2575 2556..4016 7260 99.9 Plus
CRMP-RE 2590 CG1411-RE 4..890 4..890 4435 100 Plus
CRMP-RB 2814 CG1411-RB 4..890 4..890 4435 100 Plus
CRMP-RE 2590 CG1411-RE 888..1128 1137..1377 1190 99.6 Plus
CRMP-RB 2814 CG1411-RB 888..1128 1137..1377 1190 99.6 Plus
CRMP-RB 2814 CG1411-RB 1129..1352 1999..2222 1120 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
CRMP-PA 589 CG1411-PA 1..254 134..895 1340 99.2 Plus
CRMP-PB 332 CG1411-PB 1..252 134..889 1337 100 Plus
CRMP-PE 594 CG1411-PE 1..252 134..889 1337 100 Plus
CRMP-PA 589 CG1411-PA 382..589 2718..3341 1095 100 Plus
CRMP-PE 594 CG1411-PE 387..594 2718..3341 1095 100 Plus
CRMP-PB 332 CG1411-PB 253..332 1139..1378 420 100 Plus
CRMP-PE 594 CG1411-PE 253..331 1139..1375 415 100 Plus
CRMP-PA 589 CG1411-PA 252..326 1996..2220 369 100 Plus
CRMP-PE 594 CG1411-PE 332..386 2554..2718 295 98.2 Plus
CRMP-PA 589 CG1411-PA 328..381 2557..2718 294 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5575778..5577828 742..2790 10140 99.9 Plus
3R 32079331 3R 5578437..5579191 3264..4018 3775 100 Plus
3R 32079331 3R 5577896..5578370 2790..3264 2375 100 Plus
3R 32079331 3R 5574663..5574853 277..467 955 100 Plus
3R 32079331 3R 5575239..5575375 543..679 685 100 Plus
3R 32079331 3R 5571111..5571231 4..124 605 100 Plus
3R 32079331 3R 5574252..5574341 124..213 450 100 Plus
3R 32079331 3R 5574913..5574991 468..546 395 100 Plus
3R 32079331 3R 5574402..5574468 212..278 335 100 Plus
3R 32079331 3R 5575434..5575500 678..744 335 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5316609..5318659 742..2790 10160 99.8 Plus
3R 31820162 3R 5319268..5320022 3264..4018 3775 100 Plus
3R 31820162 3R 5318727..5319201 2790..3264 2375 100 Plus
3R 31820162 3R 5315494..5315684 277..467 955 100 Plus
3R 31820162 3R 5316070..5316206 543..679 685 100 Plus
3R 31820162 3R 5311942..5312062 4..124 605 100 Plus
3R 31820162 3R 5315083..5315172 124..213 450 100 Plus
3R 31820162 3R 5315744..5315822 468..546 395 100 Plus
3R 31820162 3R 5316265..5316331 678..744 335 100 Plus
3R 31820162 3R 5315233..5315299 212..278 335 100 Plus
Blast to na_te.dros performed 2014-11-26 20:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 229..273 1530..1574 126 75.6 Plus

FI04515.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:22:49 Download gff for FI04515.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1404097..1404848 3265..4016 94   Plus
chr3R 1403556..1404029 2791..3264 100 -> Plus
chr3R 1402409..1403487 1714..2790 99 -> Plus
chr3R 1401438..1402352 743..1657 97 == Plus
chr3R 1401095..1401157 680..742 100 -> Plus
chr3R 1400900..1401034 545..679 100 -> Plus
chr3R 1400572..1400648 468..544 100 -> Plus
chr3R 1400322..1400512 277..467 100 -> Plus
chr3R 1400062..1400125 213..276 100 -> Plus
chr3R 1399912..1399999 125..212 100 -> Plus
chr3R 1396767..1396890 1..124 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed on 2008-12-08 15:48:32 has no hits.
Sim4 to dmel-all-CDS-r5.32.fasta performed on 2011-03-16 21:15:13 has no hits.
Sim4 to dmel-all-CDS-r5.52.fasta performed on 2013-08-04 00:58:21 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed on 2014-11-26 21:22:49 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:54:03 Download gff for FI04515.complete
Subject Subject Range Query Range Percent Splice Strand
CRMP-RC 1..4018 1..4016 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:15:13 Download gff for FI04515.complete
Subject Subject Range Query Range Percent Splice Strand
CRMP-RC 1..4018 1..4016 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed on 2013-08-04 00:58:21 has no hits.
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-12 16:27:38 Download gff for FI04515.complete
Subject Subject Range Query Range Percent Splice Strand
CRMP-RC 1..4018 1..4016 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed on 2014-11-26 21:22:49 has no hits.
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:22:49 Download gff for FI04515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5578438..5579189 3265..4016 100   Plus
3R 5577897..5578370 2791..3264 100 -> Plus
3R 5575779..5577828 743..2790 99 -> Plus
3R 5575436..5575498 680..742 100 -> Plus
3R 5575241..5575375 545..679 100 -> Plus
3R 5574913..5574989 468..544 100 -> Plus
3R 5574663..5574853 277..467 100 -> Plus
3R 5574403..5574466 213..276 100 -> Plus
3R 5574253..5574340 125..212 100 -> Plus
3R 5571108..5571231 1..124 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:58:21 Download gff for FI04515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1404160..1404911 3265..4016 100   Plus
arm_3R 1403619..1404092 2791..3264 100 -> Plus
arm_3R 1401501..1403550 743..2790 99 -> Plus
arm_3R 1401158..1401220 680..742 100 -> Plus
arm_3R 1400963..1401097 545..679 100 -> Plus
arm_3R 1400635..1400711 468..544 100 -> Plus
arm_3R 1400385..1400575 277..467 100 -> Plus
arm_3R 1400125..1400188 213..276 100 -> Plus
arm_3R 1399975..1400062 125..212 100 -> Plus
arm_3R 1396830..1396953 1..124 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:46:02 Download gff for FI04515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5319269..5320020 3265..4016 100   Plus
3R 5318728..5319201 2791..3264 100 -> Plus
3R 5316610..5318659 743..2790 99 -> Plus
3R 5316267..5316329 680..742 100 -> Plus
3R 5316072..5316206 545..679 100 -> Plus
3R 5315744..5315820 468..544 100 -> Plus
3R 5315494..5315684 277..467 100 -> Plus
3R 5315234..5315297 213..276 100 -> Plus
3R 5315084..5315171 125..212 100 -> Plus
3R 5311939..5312062 1..124 99 -> Plus

FI04515.pep Sequence

Translation from 133 to 1005

> FI04515.pep
MSTSPKPVKKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFV
GPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGT
KAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITW
WSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNG
VAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLA
HQVRPLPCRQTVGDGWEEGGRRRRSVSMPVECHCALCRAL*

FI04515.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20697-PA 659 GF20697-PA 1..252 1..252 1326 98.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12914-PA 589 GG12914-PA 1..277 1..275 1358 94.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20890-PA 593 GH20890-PA 1..253 1..253 1223 87.7 Plus
Dgri\GH15883-PA 597 GH15883-PA 1..277 1..275 1223 85.2 Plus
Dgri\GH20891-PA 522 GH20891-PA 1..199 1..253 837 64.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
CRMP-PA 589 CG1411-PA 1..277 1..275 1341 94.2 Plus
CRMP-PB 332 CG1411-PB 1..252 1..252 1337 100 Plus
CRMP-PE 594 CG1411-PE 1..252 1..252 1337 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20644-PA 590 GI20644-PA 1..250 1..253 1233 90.5 Plus
Dmoj\GI23638-PA 588 GI23638-PA 1..277 1..275 1150 78.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22308-PA 661 GL22308-PA 1..252 1..252 1320 97.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12765-PA 593 GA12765-PA 1..277 1..275 1327 92.1 Plus
Dpse\GA12765-PB 598 GA12765-PB 1..252 1..252 1316 97.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10816-PA 591 GM10816-PA 1..204 1..204 1096 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19795-PA 589 GD19795-PA 1..277 1..275 1358 94.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21611-PA 592 GJ21611-PA 1..253 1..253 1234 89.7 Plus
Dvir\GJ24714-PA 588 GJ24714-PA 1..277 1..275 1199 82.3 Plus
Dvir\GJ21612-PA 533 GJ21612-PA 8..245 16..253 1109 83.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22508-PA 658 GK22508-PA 1..253 1..253 1325 97.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10139-PA 589 GE10139-PA 1..277 1..275 1356 93.9 Plus

FI04515.hyp Sequence

Translation from 133 to 1005

> FI04515.hyp
MSTSPKPVKKVPIHLQSAQNRVYIKNGEIVNHDKSFKADVYIEDGIIKFV
GPSSEITIPGGVRTIDASGLMIIPGGIDPHTHMQLPFGGAVAVDDFYHGT
KAAVAGGTTMIIDFVLPNKHESMIEAYDKWRSWADPKVCCDYGLHVGITW
WSKSVSEEIGILCKELGVNSFKTFMAYKGLYQLNDSDLLDVFERIRHLNG
VAMVHAENGDIIAKNTQRLLAEGINGPEGHELSRPEEVEAEAVHRACVLA
HQVRPLPCRQTVGDGWEEGGRRRRSVSMPVECHCALCRAL*

FI04515.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
CRMP-PA 589 CG1411-PA 1..277 1..275 1341 94.2 Plus
CRMP-PB 332 CG1411-PB 1..252 1..252 1337 100 Plus
CRMP-PE 594 CG1411-PE 1..252 1..252 1337 100 Plus