Clone FI04552 Report

Search the DGRC for FI04552

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:45
Well:52
Vector:pFlc-1
Associated Gene/TranscriptCNMaR-RA
Protein status:FI04552.pep: gold
Sequenced Size:2718

Clone Sequence Records

FI04552.complete Sequence

2718 bp assembled on 2008-12-23

GenBank Submission: BT056258.1

> FI04552.complete
AGTTGCGCGCTCATTGTCCTGCTGGTTGGACGAACCGGCAAGGAATCAAC
AGCCCAATTGGCCGCCAAACTCAACAGAGCGTTTGAAAGACAGCGAATCC
CGAATATAAACACACGCATTCGATTCCGAGAATTATCAATTAATTGAAAA
AATATCGAAGAATGTCTATGGCTTGCGCAAAAAAAAATTCAATTCAAAAA
TAAAACTAGACTGCAAATAAATTGTGCTTTGTGAAAACAAGAACCCTCAG
AAGTTTTTTGAGGAAAACAAGAACTTTTTGTGTGTGGCAAAAGTTTTTTT
TTTATGATTTTACCTGGCGTTTCTTCTTTGTTTACATCATTACGAACTGT
GTGGAAAAAATGTTTGGCCGATAATGAACTTATAACACATAGGCGAACAG
CAATCGGAAGTTTCAACAAGTTTGCCGAAAGAAAAGTTTGGCACAAAGTT
TGAAAGTTAAAAATTTCTTAATTAAGATTAAGTTAAGCGGAAACAGAAAT
TCGTGTGAAAGTGCCAAGTGAATTAGTTTGATTGGCCAATCAATTGCAAT
GGACAAACATGTCCGAGGAAATGCAAATAGTTTTTGCCTTTGACCTTCTT
CAATTAAAAGCAAAATAAATAGAGCAGTGCAGTAATGAGCGTGTCCAAGT
GGAATACAAACTGTTCCGGAAATATCTCAAAATAAAAGCAACTAACCAAC
AAAGGACTATTGCATTGCATTAAGCATGGATATGGAGTATATAACTAGCA
GTAGTGGCAACATAACTGCCACTACAGAAGCAGATTTCAGTTCATCTTTG
GGCGAATCCAATGTCACGGAATACAATACAACGGAAATGGACGCGAATGA
ATCAGCTGGCGAGGATGAGGAGATGCTAAGGATAGCCTTTTTTATAGGGC
ACTTCGTGCATCAATACTATATACCAGTGCTTTGCTGCACGGGCAGCATT
GGCAATATCCTCTCCGTGTTTGTCTTCTTTAGGACCAAGTTGAGAAAGTT
GTCCTCCAGCTTTTACCTGGCCGCTCTCGCAGTGAGCGACACCTGCTTCC
TGGCCGGACTCTTCGCACAGTGGCTGAACTTCCTCAATGTGGATATCTAT
AATCAAAACTACTTTTGCCAGTTCTTCACGTTCTTCAGCTACCTGGCCAG
CTTCTGCTCCGTCTGGTTTGTGGTGGCCTTCACCGTGGAGCGCTTCATTG
CCGTCATCTATCCACTGAAGCGCCAGACCATGTGCACCGTGCGCCGGGCC
AAGATCGTCCTGTTTTGTTTGACACTCGTGGGATGTCTGCACTGTCTGCC
CTATATAGTCATTGCCAAGCCGGTGTTTATGCCCAAATTGAACACGACCA
TTTGCGATCTCAACTCGGAATACAAAGAACAACTGGCCCTCTTCAACTAC
TGGGACACCATAGTTGTCTATGCGGTGCCCTTCACCACCATCGCCGTTCT
GAACACCTGTACAGGTTGTACGGTGTGGAAGTTCGCCACCGTTCGCCGAA
CGCTGACCATGCACAAGATGAAGCCCCAAACGAACAGCATGCCATCGAAC
TCGTCGAACTCATCGGGCGGAGCCTCATCTGCAGTGGCCTCGTACCGCCT
ATCGGCATCGCTGAAGCGCCAGAAGTCGACGGGAACGCATCCAAGTGGAC
AGCATAATGTGGCCAACAGGCAGACGGATGATCAGGAGCAGCAACAGCAG
TCGCAGCAGCATCAAATAAACAATTGCCAACACCATTGCGAGATTACGCA
GAAACCAGCCCGTCGCAAGGTGCAAAACTCATCGCAGCTCAAGGTAACCA
AAATGCTGCTAATTGTCTCGACGGTTTTTGTTTGCCTCAATTTGCCCAGC
TGCCTGCTGCGCATCGAGGCCTATTGGGAGACGGAGTCGGCCCGAAACCA
GAATTCCACAATTGCTTTGCAATATATTTTTCACGCTTTCTTCATCACCA
ATTTTGGCATCAATTTCGTGCTTTACTGCGTCAGTGGACAGAATTTCCGC
AAAGCCGTTTTGAGTATTTTCCGAAGGGTTTCATCCGCTCAACGGGAGGC
GGGAAACACCCAAGTGACAGTTTCTGAATACTGTCGCAATACTGGCACAT
CCACACGTCGTCGAATGATGACGCAACATTGTTGGAACGAAATGCACGAG
TTGCATCCACTCAAGTGAATGGCTGAGCTTACGGGAAAATTAACTTAGAG
GCGCTGCAAAGGCCAATGAATGATGTGAAATTGCGAAATAGGCCGCGGGA
TGAGCCGGAATTTCGTTTTTAATTAGATTTCAGCAAACATAATATGAAAT
AAGAGCACAAAGAACGTAAAAATTACTTTACGAAATATGGAATGGAGCAC
AGGCGAAACCTTTATTTTCTCATGTTTGTCATAGCCAAGCGGAATCAAAC
AAAAATGATAAAATCAAAAGCCGACTTCGATTGATTTAAGTGTTTAACTA
ACCACATAGTAATAGAATAATTAACTTTTGTTTTGCTTCCCAAAGTATAC
GCATATTTAAGCAGCTATTATAACGAACCTCAAATTTGAATTCAAATCCG
CACGCCAAACTTAATTGAAACCCAACCACAGAAATACAATTTGAAAACGT
CAATCGTAAAACCCAATAGATTAGATTAATAAAAACTTATAACTGTCTAA
CCAACCAAACGCGAAAATGTATTCATGTAATAAATGTTAATTTCGTTAAA
CGAAAAAAAAAAAAAAAA

FI04552.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG33696-RA 2708 CG33696-RA 1..2708 1..2706 13455 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9635992..9637371 1..1377 6495 98.7 Plus
chr3L 24539361 chr3L 9650674..9651306 2068..2700 3090 99.2 Plus
chr3L 24539361 chr3L 9642860..9643098 1520..1758 1165 99.2 Plus
chr3L 24539361 chr3L 9642224..9642367 1377..1520 705 99.3 Plus
chr3L 24539361 chr3L 9643493..9643616 1757..1880 620 100 Plus
chr3L 24539361 chr3L 9645373..9645493 1879..1999 605 100 Plus
chr3L 24539361 chr3L 9645612..9645683 1999..2070 345 98.6 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
CNMaR-RA 1443 CG33696-PA 1..1443 726..2168 7215 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:19 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
CNMaR-RA 2704 CG33696-RA 1..2702 1..2700 13430 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
CNMaR-PA 480 CG33696-PA 1..480 726..2165 2274 100 Plus
Proc-R-PE 545 CG6986-PE 4..170 792..1271 214 32.6 Plus
Proc-R-PD 545 CG6986-PD 4..170 792..1271 214 32.6 Plus
Proc-R-PC 545 CG6986-PC 4..170 792..1271 214 32.6 Plus
Proc-R-PB 545 CG6986-PB 4..170 792..1271 214 32.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9644109..9645487 1..1377 6830 99.9 Plus
3L 28110227 3L 9658799..9659437 2068..2706 3165 99.7 Plus
3L 28110227 3L 9650980..9651218 1520..1758 1195 100 Plus
3L 28110227 3L 9650344..9650487 1377..1520 720 100 Plus
3L 28110227 3L 9651604..9651727 1757..1880 620 100 Plus
3L 28110227 3L 9653483..9653603 1879..1999 605 100 Plus
3L 28110227 3L 9653722..9653793 1999..2070 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9637209..9638587 1..1377 6840 99.8 Plus
3L 28103327 3L 9651899..9652537 2068..2706 3165 99.6 Plus
3L 28103327 3L 9644080..9644318 1520..1758 1195 100 Plus
3L 28103327 3L 9643444..9643587 1377..1520 720 100 Plus
3L 28103327 3L 9644704..9644827 1757..1880 620 100 Plus
3L 28103327 3L 9646583..9646703 1879..1999 605 100 Plus
3L 28103327 3L 9646822..9646893 1999..2070 360 100 Plus
Blast to na_te.dros performed 2014-11-27 04:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1089..1140 1681..1735 132 76.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6849 1670..1735 123 65.2 Plus
roo 9092 roo DM_ROO 9092bp 1090..1135 1670..1715 122 73.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2332..2386 1681..1735 122 69.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2337..2410 1664..1735 121 68 Plus

FI04552.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:31:29 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9650677..9651308 2071..2702 99   Plus
chr3L 9645613..9645683 2000..2070 98 -> Plus
chr3L 9645375..9645493 1881..1999 100 -> Plus
chr3L 9643495..9643616 1759..1880 100 -> Plus
chr3L 9642860..9643098 1520..1758 99 -> Plus
chr3L 9642224..9642366 1377..1519 99 -> Plus
chr3L 9635992..9637370 1..1376 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:37:38 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
CG33696-RA 1..1443 726..2168 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:27:12 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
CG33696-RA 1..1443 726..2168 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:02:51 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
CG33696-RA 1..1443 726..2168 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:31:29 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
CNMaR-RA 1..1443 726..2168 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:37:37 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
CG33696-RA 1..2704 1..2702 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:27:12 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
CG33696-RA 1..2704 1..2702 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:02:51 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
CG33696-RA 1..2704 1..2702 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:31:29 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
CNMaR-RA 1..2704 1..2702 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:31:29 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9658802..9659433 2071..2702 99   Plus
3L 9653723..9653793 2000..2070 100 -> Plus
3L 9653485..9653603 1881..1999 100 -> Plus
3L 9651606..9651727 1759..1880 100 -> Plus
3L 9650980..9651218 1520..1758 100 -> Plus
3L 9650344..9650486 1377..1519 100 -> Plus
3L 9644109..9645486 1..1376 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:02:51 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9651902..9652533 2071..2702 99   Plus
arm_3L 9646823..9646893 2000..2070 100 -> Plus
arm_3L 9646585..9646703 1881..1999 100 -> Plus
arm_3L 9644706..9644827 1759..1880 100 -> Plus
arm_3L 9644080..9644318 1520..1758 100 -> Plus
arm_3L 9643444..9643586 1377..1519 100 -> Plus
arm_3L 9637209..9638586 1..1376 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:59:46 Download gff for FI04552.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9651902..9652533 2071..2702 99   Plus
3L 9646823..9646893 2000..2070 100 -> Plus
3L 9646585..9646703 1881..1999 100 -> Plus
3L 9644706..9644827 1759..1880 100 -> Plus
3L 9644080..9644318 1520..1758 100 -> Plus
3L 9643444..9643586 1377..1519 100 -> Plus
3L 9637209..9638586 1..1376 99 -> Plus

FI04552.pep Sequence

Translation from 725 to 2167

> FI04552.pep
MDMEYITSSSGNITATTEADFSSSLGESNVTEYNTTEMDANESAGEDEEM
LRIAFFIGHFVHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAA
LAVSDTCFLAGLFAQWLNFLNVDIYNQNYFCQFFTFFSYLASFCSVWFVV
AFTVERFIAVIYPLKRQTMCTVRRAKIVLFCLTLVGCLHCLPYIVIAKPV
FMPKLNTTICDLNSEYKEQLALFNYWDTIVVYAVPFTTIAVLNTCTGCTV
WKFATVRRTLTMHKMKPQTNSMPSNSSNSSGGASSAVASYRLSASLKRQK
STGTHPSGQHNVANRQTDDQEQQQQSQQHQINNCQHHCEITQKPARRKVQ
NSSQLKVTKMLLIVSTVFVCLNLPSCLLRIEAYWETESARNQNSTIALQY
IFHAFFITNFGINFVLYCVSGQNFRKAVLSIFRRVSSAQREAGNTQVTVS
EYCRNTGTSTRRRMMTQHCWNEMHELHPLK*

FI04552.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25151-PA 480 GF25151-PA 1..480 1..480 2144 86.1 Plus
Dana\GF22277-PA 491 GF22277-PA 48..180 57..182 193 32.8 Plus
Dana\GF17594-PA 649 GF17594-PA 59..238 4..192 190 30.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15397-PA 452 GG15397-PA 1..448 1..448 2076 90.9 Plus
Dere\GG18724-PA 554 GG18724-PA 40..172 57..182 198 33.6 Plus
Dere\GG19589-PA 654 GG19589-PA 63..242 4..192 177 29.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16314-PA 474 GH16314-PA 1..474 3..480 1837 73.6 Plus
Dgri\GH23507-PA 64 GH23507-PA 16..64 217..265 235 89.8 Plus
Dgri\GH12829-PA 556 GH12829-PA 30..155 57..182 190 34.4 Plus
Dgri\GH14790-PA 414 GH14790-PA 31..224 72..257 152 27.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
CNMaR-PA 480 CG33696-PA 1..480 1..480 2525 100 Plus
Proc-R-PE 545 CG6986-PE 4..170 23..182 214 32.6 Plus
Proc-R-PD 545 CG6986-PD 4..170 23..182 214 32.6 Plus
Proc-R-PC 545 CG6986-PC 4..170 23..182 214 32.6 Plus
Proc-R-PB 545 CG6986-PB 4..170 23..182 214 32.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13258-PA 471 GI13258-PA 42..471 37..480 1830 79.6 Plus
Dmoj\GI14912-PA 567 GI14912-PA 33..165 57..182 188 34.3 Plus
Dmoj\GI11844-PA 450 GI11844-PA 71..231 72..223 152 29.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12712-PA 506 GL12712-PA 38..506 9..480 2037 83.2 Plus
Dper\GL13096-PA 573 GL13096-PA 20..175 39..182 197 33.1 Plus
Dper\GL25172-PA 482 GL25172-PA 86..279 72..257 174 27.9 Plus
Dper\GL24468-PA 639 GL24468-PA 103..279 73..252 165 28.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28202-PA 509 GA28202-PA 39..509 9..480 2035 82.9 Plus
Dpse\GA20007-PA 762 GA20007-PA 43..175 57..182 197 33.6 Plus
Dpse\GA21320-PA 633 GA21320-PA 98..224 68..192 161 31.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25173-PA 448 GM25173-PA 1..444 1..448 2206 94.6 Plus
Dsec\GM12364-PA 544 GM12364-PA 36..168 57..182 199 33.6 Plus
Dsec\GM24101-PA 658 GM24101-PA 63..242 4..192 179 29.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14202-PA 479 GD14202-PA 1..479 1..480 2378 97.5 Plus
Dsim\GD18898-PA 658 GD18898-PA 63..242 4..192 178 29.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12028-PA 459 GJ12028-PA 52..457 37..448 1732 80.1 Plus
Dvir\GJ18945-PA 537 GJ18945-PA 32..164 57..182 195 34.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16625-PA 583 GK16625-PA 124..583 43..480 1765 74 Plus
Dwil\GK25308-PA 559 GK25308-PA 38..170 57..182 192 33.6 Plus
Dwil\GK20338-PA 487 GK20338-PA 79..287 72..279 184 28.7 Plus
Dwil\GK14702-PA 709 GK14702-PA 204..428 37..265 159 25.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20863-PA 460 GE20863-PA 1..456 1..448 2090 90.6 Plus
Dyak\GE16363-PA 552 GE16363-PA 40..172 57..182 196 33.6 Plus
Dyak\GE26264-PA 658 GE26264-PA 67..246 4..192 179 29.3 Plus

FI04552.hyp Sequence

Translation from 725 to 2167

> FI04552.hyp
MDMEYITSSSGNITATTEADFSSSLGESNVTEYNTTEMDANESAGEDEEM
LRIAFFIGHFVHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAA
LAVSDTCFLAGLFAQWLNFLNVDIYNQNYFCQFFTFFSYLASFCSVWFVV
AFTVERFIAVIYPLKRQTMCTVRRAKIVLFCLTLVGCLHCLPYIVIAKPV
FMPKLNTTICDLNSEYKEQLALFNYWDTIVVYAVPFTTIAVLNTCTGCTV
WKFATVRRTLTMHKMKPQTNSMPSNSSNSSGGASSAVASYRLSASLKRQK
STGTHPSGQHNVANRQTDDQEQQQQSQQHQINNCQHHCEITQKPARRKVQ
NSSQLKVTKMLLIVSTVFVCLNLPSCLLRIEAYWETESARNQNSTIALQY
IFHAFFITNFGINFVLYCVSGQNFRKAVLSIFRRVSSAQREAGNTQVTVS
EYCRNTGTSTRRRMMTQHCWNEMHELHPLK*

FI04552.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
CNMaR-PA 480 CG33696-PA 1..480 1..480 2525 100 Plus
Proc-R-PE 545 CG6986-PE 4..170 23..182 214 32.6 Plus
Proc-R-PD 545 CG6986-PD 4..170 23..182 214 32.6 Plus
Proc-R-PC 545 CG6986-PC 4..170 23..182 214 32.6 Plus
Proc-R-PB 545 CG6986-PB 4..170 23..182 214 32.6 Plus