Clone FI04554 Report

Search the DGRC for FI04554

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:45
Well:54
Vector:pFlc-1
Associated Gene/TranscriptCG10947-RB
Protein status:FI04554.pep: gold
Sequenced Size:2618

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10947 2008-12-18 5.12 accounting

Clone Sequence Records

FI04554.complete Sequence

2618 bp assembled on 2008-11-07

GenBank Submission: BT057992.1

> FI04554.complete
AGTTTGTCGTCGTCGCTCATACGCAACGTTGGCCGGGCGGAAAACAAGAG
TTTCATTGAATTTCATTGAGTTTGTTGCTACTTTTGCCGCGAGTGCTGCG
GGAAAATATTTGTGTGTGGCTTTTAATATTGTTGGAAAAAATCATCAAAG
GAAAATATCTCAAATGCCAAGCATTTTGTGAATGGAAAGGTACAACAAAA
ATGATTAAATATGTGTTAAGTGACGAGTATTAAATAAATGTATCAAGAGA
ACACATATCTTAAGCACTTGGACTCAACTGCCTCGCCGAGAGCGTTTTGA
CTGGGCAGAAAATGGAAAACTGAGAAGTGACAGAGAGAGTGAATCAAATA
AGGCCTGAAGTAAGATGTCAGCAGCTTTAGTACAGAAGGCGACGGAAACT
CAACTCGATCAGACACCGGAAGTGGGTGTGGCACAGTTGGCAACTATATC
GTTGCTACTGCAGTACGACATTGACAACACACTGAATGCGCTCAAGGAGC
ACAAGAAGATGACGCTGGACGCTCGATTGGGCGGCGAGGTGGCCGCCGCA
GTCAACAACAACCAGGACAAGGACATAAACCGCAATCTGCCGGAGCAGAC
CGAACTGGAGGAGGATCTGCGACTCAAGAGCGGCGAGAACGGCTTCATGC
CGCCCACTCCGCCGGCGACGCCCAACCTGCAGAGCACTGCCCAGAAGCGC
TGGAAGATCCTGGCCAAGGTGCTGCGCAAGGATTCCGAGGAGACGGTGTC
CTCGTCCAGCGATGAGTTCGCCGAGGAGCAAACTGCATCCGTGCGGCGCT
TCAAGAGCTTCGATCTGCTCCGCCAGGACAGCTTCGAGGATCACGTGAGT
CTGAAGTGCTTGGGCAAGACGGAGAACTGGTACAAATACCGCATGCAGCT
GGAGAACGAGTCGGAGTACTCGGTGAACATCCACCACATGGAGCGTCAGC
TGACCGCAAGTGATCTGATGGGCTTCAATAACACGGGCAACATATGCGTT
TGGCCCTCGGAGGAGGCTTTGACCGCGCTGGTCCTCTCGGAGGTGGCTTC
ATATCGAGGCAAGTGGATCCTGGAACTCGGTGGCGGGTTCACCTCCCTGG
CTGGCCTCATGCTGGCCAAGTATGCCACTCCGTATGCCGTTCACCTGACC
GATGGCAATGAGATATCGGTGGAGAACGTGAGGAAAACCGTTTGCCTCAA
CGAGCTGAGCTGCTATACCAAGTGCTCGGTTCTGAAATGGCAGGAAAAGT
CTGCCCGATCGCAGGCAGAGCAGGCCAAGTTCGACTTCATCCTCTGCGCC
GACTGCCTGTTCTTCGACGAGGCCCGATCCGCCCTGGTGGACACCATCTG
GTACTATCTGGCGCCCGAGGGATCGGCCCTGATTATGGCTCCACGTCGCG
GGCGCACCTTGAGCGTTTTTCAGGACGAGTGCGTGGCCAGGGGCTTCCGC
GTGGAGTTGGCCACTCGCTATAACGAGACCATCTGGCAGCGGCATCTCCA
GCTGAAGGCGGACTCCGCCCTCTACGACGAGGACCTCCACTACCCGTTGC
TCCTGCGGCTGTGCAAGAGCCACAGCTAGGAGATCGAAGGAGATCGAAGG
GGTTAGGACTTAATGGCAAGCCACTTGGCTGCAGTAGGTGCAATTAAACT
TAGTCAATGTTTTAGTTGATAGCAAGCAAATTCCAGTTTACACCTTAAAC
AATGATGAGGCCAACAGCGGGAATAGAAATTCTCCTGTTGGGCTCGACGG
ACAAAAAGAAATTCCTTCCACACTGAAGTAAAATGTAGCAAGTCAAACTC
GTTAGACTGGTGCTAGAAATATATGAAAAAATCTATATGATTATAAATGT
ATTCGGTTTAATGCACACAATAGCTTTCACGTTAGCCTTGGTGGACATTG
AAGAGGTTATGATATTCTGTTGGTTTTCCATTTGGCCAAACAAAGAGTTT
AATTTCTATTTGCGAGAGTAAAGTAAATTAATCAACGTAAAAATGAATAA
TTACTCAATTACTGAAATATGTTTTGTTTGTAACTCACTCGTTGAGGGCG
TATGTGAATCCCTTGTTCGTTTGAAATTCCTCTCGGGACTTATGCAACCA
TATCTAAAATACTCAAAGTGAATGTTAATGAATATAATGGTACATATTCA
CCGCTTAAAAGCACCAGTCTAGTGATCACCTTTAGCTCGTAGTTCACTGT
TAAGTTGTGTAACAAAAAATTCCTTTGATATGTTAATTTGATTTCCGCTG
ATTCCACAAGTTTTGTAACGTTTTTTTTTACAAATACTCCTCGTTATGTA
TATGTAGTTACCTCTATGTATGTTACACACCCAACACCCAACACCCACAC
CCACACACAAGTATTATTTAAATTTACGTGTACGCTGAATAGCATACTTT
TTGGCTGCTTTCGTAGAAGGGCAGAGAGCACCGTCAACTGAAAAAAGGAA
AACGGAATTCGGTTCTCGGAAACCGCACACAAAGCAGCAGCGCTCGACCA
ATTAATTAATAGTTAACTAAACTTAGTGTACTGTAATTACCTAGAGCATG
TGCTAATGGTTATATGATGATGATGAGATAAATACAGTATCGAAATGCCA
CATAAAAAAAAAAAAAAA

FI04554.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG10947-RB 2702 CG10947-RB 60..2663 1..2604 13005 99.9 Plus
CG10947-RC 2719 CG10947-RC 340..2641 303..2604 11495 99.9 Plus
CG10947-RC 2719 CG10947-RC 152..341 1..190 950 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20383672..20385971 2603..303 11425 99.9 Minus
chr2L 23010047 chr2L 20397479..20397782 304..1 1520 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG10947-RD 1215 CG10947-PD 1..1215 365..1579 6075 100 Plus
CG10947-RC 1215 CG10947-PC 1..1215 365..1579 6075 100 Plus
CG10947-RB 1215 CG10947-PB 1..1215 365..1579 6075 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:20 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG10947-RB 2605 CG10947-RB 3..2605 1..2603 13000 100 Plus
CG10947-RD 2767 CG10947-RD 467..2767 303..2603 11490 100 Plus
CG10947-RC 1727 CG10947-RC 191..1727 303..1839 7670 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG10947-PD 404 CG10947-PD 1..404 365..1576 2023 100 Plus
CG10947-PC 404 CG10947-PC 1..404 365..1576 2023 100 Plus
CG10947-PB 404 CG10947-PB 1..404 365..1576 2023 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20385292..20387593 2604..303 11495 100 Minus
2L 23513712 2L 20399091..20399394 304..1 1520 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20385292..20387593 2604..303 11495 99.9 Minus
2L 23513712 2L 20399091..20399394 304..1 1520 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:24:59 has no hits.

FI04554.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:50:41 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20397480..20397782 1..303 100   Minus
chr2L 20383672..20385970 304..2603 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:35:40 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG10947-RC 1..1215 365..1579 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:20:06 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG10947-RC 1..1215 365..1579 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:09 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG10947-RB 1..1215 365..1579 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:50:41 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG10947-RB 1..1215 365..1579 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:35:39 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG10947-RB 1..1840 1..1840 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:20:06 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG10947-RB 1..2603 1..2603 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:09 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG10947-RB 3..2605 1..2603 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-07 18:02:47 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG10947-RB 1..1840 1..1840 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:50:41 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG10947-RB 3..2605 1..2603 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:50:41 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20399092..20399394 1..303 100   Minus
2L 20385293..20387592 304..2603 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:09 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20399092..20399394 1..303 100   Minus
arm_2L 20385293..20387592 304..2603 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:51:29 Download gff for FI04554.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20399092..20399394 1..303 100   Minus
2L 20385293..20387592 304..2603 99 <- Minus

FI04554.pep Sequence

Translation from 364 to 1578

> FI04554.pep
MSAALVQKATETQLDQTPEVGVAQLATISLLLQYDIDNTLNALKEHKKMT
LDARLGGEVAAAVNNNQDKDINRNLPEQTELEEDLRLKSGENGFMPPTPP
ATPNLQSTAQKRWKILAKVLRKDSEETVSSSSDEFAEEQTASVRRFKSFD
LLRQDSFEDHVSLKCLGKTENWYKYRMQLENESEYSVNIHHMERQLTASD
LMGFNNTGNICVWPSEEALTALVLSEVASYRGKWILELGGGFTSLAGLML
AKYATPYAVHLTDGNEISVENVRKTVCLNELSCYTKCSVLKWQEKSARSQ
AEQAKFDFILCADCLFFDEARSALVDTIWYYLAPEGSALIMAPRRGRTLS
VFQDECVARGFRVELATRYNETIWQRHLQLKADSALYDEDLHYPLLLRLC
KSHS*

FI04554.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15374-PA 418 GF15374-PA 1..418 1..404 1631 76.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21573-PA 404 GG21573-PA 1..404 1..404 2092 96.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11655-PA 434 GH11655-PA 28..434 13..404 1619 78.2 Plus
Dgri\GH23832-PA 309 GH23832-PA 28..308 13..278 980 72.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG10947-PD 404 CG10947-PD 1..404 1..404 2091 100 Plus
CG10947-PC 404 CG10947-PC 1..404 1..404 2091 100 Plus
CG10947-PB 404 CG10947-PB 1..404 1..404 2091 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17957-PA 449 GI17957-PA 42..449 24..404 1630 78.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26414-PA 394 GL26414-PA 1..394 1..404 1463 71.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10659-PA 434 GA10659-PA 1..434 1..404 1724 80.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23329-PA 404 GM23329-PA 1..404 1..404 2140 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21704-PA 404 GD21704-PA 1..404 1..404 2138 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17729-PA 443 GJ17729-PA 1..443 1..404 1677 74.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18123-PA 421 GK18123-PA 8..421 1..404 1646 77.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12595-PA 404 GE12595-PA 1..404 1..404 2109 97.5 Plus

FI04554.hyp Sequence

Translation from 364 to 1578

> FI04554.hyp
MSAALVQKATETQLDQTPEVGVAQLATISLLLQYDIDNTLNALKEHKKMT
LDARLGGEVAAAVNNNQDKDINRNLPEQTELEEDLRLKSGENGFMPPTPP
ATPNLQSTAQKRWKILAKVLRKDSEETVSSSSDEFAEEQTASVRRFKSFD
LLRQDSFEDHVSLKCLGKTENWYKYRMQLENESEYSVNIHHMERQLTASD
LMGFNNTGNICVWPSEEALTALVLSEVASYRGKWILELGGGFTSLAGLML
AKYATPYAVHLTDGNEISVENVRKTVCLNELSCYTKCSVLKWQEKSARSQ
AEQAKFDFILCADCLFFDEARSALVDTIWYYLAPEGSALIMAPRRGRTLS
VFQDECVARGFRVELATRYNETIWQRHLQLKADSALYDEDLHYPLLLRLC
KSHS*

FI04554.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG10947-PD 404 CG10947-PD 1..404 1..404 2091 100 Plus
CG10947-PC 404 CG10947-PC 1..404 1..404 2091 100 Plus
CG10947-PB 404 CG10947-PB 1..404 1..404 2091 100 Plus