Clone FI04569 Report

Search the DGRC for FI04569

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:45
Well:69
Vector:pFlc-1
Associated Gene/TranscriptCG10171-RB
Protein status:FI04569.pep: gold
Sequenced Size:1780

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10171 2008-12-18 5.12 accounting

Clone Sequence Records

FI04569.complete Sequence

1780 bp assembled on 2008-10-12

GenBank Submission: BT046137.1

> FI04569.complete
AAAAAACCCGCCGGAGAAAGTGGCGATAAACAGCGCCCATAAAACGTCAA
GATGCGTGACTGGATGCCAGTGCTCTTCTGCGGACTGTCCGTGCCGATCT
CGCTGTTCATGTGGCTGGGCAATGTGGCGCTGTCCAAGTTCTGGAGCAGT
GACTTTGAGGGTTATCCGACAGAGTCCCGGGTGATTCCGCCGGTGCGCTG
GCTCTTCTCCACACTGGCGCCCTTGGCCCTGATGACTGTGGCTCTGCGCC
GGAGGAGCGTCAACCGATCTGGAGCTGCGCTGGGCATTCTGGTGGCCTTC
ATTCTCTCCATCGCCAGCCATCCGTTCTTCGCCAGCTTGGTGGTGTTCTT
CTTCAGCTCATCGCGGGCCACCAAGTTCCGCGCGCACATGAAACGCCGTT
TCGAGAGCGATTTTCGCGAGGGCGAAGGCCAACGAAACTGGATACAGGTA
CTCTGCAACGGAGGCATGGCCGCCCAGCTTGCATTGCTTTATCTGCTGGA
CTGCGGTAGTGGCGAGCGGGCGGTGGACTTCGCACGAGAATACCGATCCA
GCTGGCTGGGTGTGGCCGTTATGAGTGCGTTTGCCTGTTGCAATGGCGAC
ACCTGGTCCAGTGAACTAGGATCCGTGCTGTCGCAACGCGATCCAGTTTC
TATCATCACCTGGCGCAGAGTGCCGCGCGGTACCAATGGTGGGGTTTCGT
TGCTCGGCGTCGCGGTGAGTCTGCTCGGCGGTCTGCTCGTCGGCTTTGGC
TATTTCGTCACCGTTCGTTACACGGTTGAGGCCAAAATGCTTCTGATTAG
CCCACCACAATGGCCAATCATCGCCTTCGGTGGCATCGCTGGACTTTTTG
GGTCCCTTTTGGACTCTGTCCTAGGTGGTCTGCTGCAGTTCTCGGGCATC
AATGAGGAAGGCAAGATTGTGGATACACCTGGAAAGGGAGTGCGCCACGT
AAGCGGACTGCGCATCCTGGACAACCATAGTGTCAACCTGATTTCCAGCA
TCGTCACCGGCGTCACCATTCCTCTCCTGGCCCAGAGATTCTGGCCCGTG
CGCTAATGCTGTTTTGGATTAGGATTAGCTGCATTCAATAGCTAAAAATG
TCAAAGGCTGCCTCACAAGATTGAATTCCGTGTTAAACATAAACCCATCC
TCATAAAGCCTTTTAGACAGATATATTTTTATGAAGCTTACATATCGCCT
AGCGAACTAACCAACCTATGAGACTCGATGAAAACAACGATTGGGCACCG
AATAGCCAAGGCAGTTAGATTATATTTACTCTAAGGTAGCTAACCATGTT
CCTTTACGGATTATGACGTTGTTGTTACTGTGACTGTTCACCTCCATTTT
GTGTATTAACTCTACTAAACACGAACCGTACATGTGGATCTATTGTCATT
GTCTCGAAATTCTCGTACGTGACGGAATACATTTTCTGATTTGGTTATGT
ATATTCTTATGGCGTCATCTCAAGTTGTTTTCAACAATTTGGAGATCAAT
GATTGGTTCCCGCTGGAATAATTTTAGCAGACCTCGCTCCAAATCGAATG
TTTTGCTTATTGCACAAGCAATTGCTGTTGTGGTGATTAAAATATTCATG
AAATTTCTATAACACAATTCGAAATTTTTGAATTTGAGGTAATAGAATAG
AATTAAGTTCTTCAACTGAGGGTTTTAAAAATATCTTTTGTTCGAAATAT
AGCTACTACTCATAAAGTCTTCGAATCCATTGTTGTTAGTACATTAAAAC
ATGAATCCAATTGGAAAAAAAAAAAAAAAA

FI04569.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:10:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG10171-RB 1807 CG10171-RB 47..1807 3..1763 8805 100 Plus
CG10171-RA 1915 CG10171-RA 297..1892 172..1767 7965 99.9 Plus
CG10171-RA 1915 CG10171-RA 140..297 3..160 790 100 Plus
CG14110-RA 1202 CG14110-RA 1129..1202 1767..1694 355 98.6 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13376822..13377838 1176..160 4965 99.2 Minus
chr3L 24539361 chr3L 13376173..13376767 1763..1169 2975 100 Minus
chr3L 24539361 chr3L 13377891..13378045 162..8 775 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG10171-RB 1005 CG10171-PB 1..1005 52..1056 5025 100 Plus
CG10171-RA 993 CG10171-PA 1..993 52..1056 4810 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG10171-RB 1845 CG10171-RB 85..1845 3..1763 8805 100 Plus
CG10171-RA 1611 CG10171-RA 11..1611 3..1615 7850 99.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:21:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG10171-PB 334 CG10171-PB 1..334 52..1053 1411 100 Plus
CG10171-PA 330 CG10171-PA 1..330 52..1053 1371 98.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13386595..13387611 1176..160 5070 99.9 Minus
3L 28110227 3L 13385942..13386540 1767..1169 2980 99.8 Minus
3L 28110227 3L 13387664..13387823 162..3 800 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13379695..13380711 1176..160 5070 99.9 Minus
3L 28103327 3L 13379042..13379640 1767..1169 2980 99.8 Minus
3L 28103327 3L 13380764..13380923 162..3 800 100 Minus
Blast to na_te.dros performed on 2014-11-27 05:21:35 has no hits.

FI04569.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:33:28 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13377893..13378053 1..160 98   Minus
chr3L 13376828..13377837 161..1170 99 <- Minus
chr3L 13376172..13376765 1171..1764 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:48:44 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 1..1005 52..1056 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:15:12 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 1..1005 52..1056 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:37:52 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 1..1005 52..1056 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:33:28 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 1..1005 52..1056 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:54:00 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 44..1660 1..1616 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:15:11 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 44..1807 1..1763 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:37:52 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 82..1845 1..1763 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-12 16:27:41 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 44..1660 1..1616 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:33:28 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
CG10171-RB 82..1845 1..1763 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:33:28 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13387666..13387825 1..160 99   Minus
3L 13386601..13387610 161..1170 100 <- Minus
3L 13385945..13386538 1171..1764 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:37:52 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13380766..13380925 1..160 99   Minus
arm_3L 13379701..13380710 161..1170 100 <- Minus
arm_3L 13379045..13379638 1171..1764 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:45:59 Download gff for FI04569.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13380766..13380925 1..160 99   Minus
3L 13379701..13380710 161..1170 100 <- Minus
3L 13379045..13379638 1171..1764 99 <- Minus

FI04569.pep Sequence

Translation from 51 to 1055

> FI04569.pep
MRDWMPVLFCGLSVPISLFMWLGNVALSKFWSSDFEGYPTESRVIPPVRW
LFSTLAPLALMTVALRRRSVNRSGAALGILVAFILSIASHPFFASLVVFF
FSSSRATKFRAHMKRRFESDFREGEGQRNWIQVLCNGGMAAQLALLYLLD
CGSGERAVDFAREYRSSWLGVAVMSAFACCNGDTWSSELGSVLSQRDPVS
IITWRRVPRGTNGGVSLLGVAVSLLGGLLVGFGYFVTVRYTVEAKMLLIS
PPQWPIIAFGGIAGLFGSLLDSVLGGLLQFSGINEEGKIVDTPGKGVRHV
SGLRILDNHSVNLISSIVTGVTIPLLAQRFWPVR*

FI04569.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10413-PA 330 GF10413-PA 1..330 1..334 1439 90.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13778-PA 330 GG13778-PA 1..330 1..334 1524 96.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14423-PA 332 GH14423-PA 5..332 3..334 1401 83.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG10171-PB 334 CG10171-PB 1..334 1..334 1726 100 Plus
CG10171-PA 330 CG10171-PA 1..330 1..334 1686 98.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13550-PA 332 GI13550-PA 5..332 3..334 1507 85.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15697-PA 330 GL15697-PA 1..330 1..334 1544 86.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10130-PA 330 GA10130-PA 1..330 1..334 1544 86.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24600-PA 330 GM24600-PA 1..330 1..334 1548 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12670-PA 271 GD12670-PA 1..36 1..36 211 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11909-PA 332 GJ11909-PA 5..332 3..334 1455 84.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16775-PA 332 GK16775-PA 2..332 1..334 1353 82.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20072-PA 330 GE20072-PA 1..330 1..334 1591 96.4 Plus

FI04569.hyp Sequence

Translation from 51 to 1055

> FI04569.hyp
MRDWMPVLFCGLSVPISLFMWLGNVALSKFWSSDFEGYPTESRVIPPVRW
LFSTLAPLALMTVALRRRSVNRSGAALGILVAFILSIASHPFFASLVVFF
FSSSRATKFRAHMKRRFESDFREGEGQRNWIQVLCNGGMAAQLALLYLLD
CGSGERAVDFAREYRSSWLGVAVMSAFACCNGDTWSSELGSVLSQRDPVS
IITWRRVPRGTNGGVSLLGVAVSLLGGLLVGFGYFVTVRYTVEAKMLLIS
PPQWPIIAFGGIAGLFGSLLDSVLGGLLQFSGINEEGKIVDTPGKGVRHV
SGLRILDNHSVNLISSIVTGVTIPLLAQRFWPVR*

FI04569.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG10171-PB 334 CG10171-PB 1..334 1..334 1726 100 Plus
CG10171-PA 330 CG10171-PA 1..330 1..334 1686 98.8 Plus