Clone FI04589 Report

Search the DGRC for FI04589

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:45
Well:89
Vector:pFlc-1
Associated Gene/Transcriptstck-RB
Protein status:FI04589.pep: gold
Sequenced Size:1405

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
stck 2008-12-18 5.12 accounting

Clone Sequence Records

FI04589.complete Sequence

1405 bp assembled on 2008-09-15

GenBank Submission: BT044500.1

> FI04589.complete
GCAGTGTTTCACTCGCCGTGATCAGAAAACGTTGTACACCAGGTGCAACA
GGTGCCGTTGTTCGCAAGTGAAAACCAGTTGAAAGCAACTAAAAAAGAAA
AGCCCACAGAATGCCGCCCGTGCAAGTCCAGGCAGCGAACATGTCGCTGG
GTGCCATGCATTGTACGCGATGTGCCGACGGCTTCGAGCCGACTGAGAAG
ATTGTTAACTCCAATGGAGAACTCTGGCACACCCAGTGCTTCGTATGTGC
CCAGTGCTTCCGACCCTTCCAGGATGGGATATTCTACGAGTTCGAGGGCC
GTAAGTACTGTGAACGCGACTTTCACGTGCTCTTCGCTCCCTGCTGCAAC
AAGTGCGGCGAGTTCGTCATCGGACGGGTCATCAAGGCCATGTCAGCTAG
CTGGCATCCACAGTGCTTCCGCTGCCAATTGTGCGCCAAGGAGCTGGCTG
ATTGCGGATTCATCAAGAACCAGAACCGCGCCTTGTGTCACGAGTGCAAT
GCCAAGGTGAAGGCGGAGATTACCGGCCGCTATGTATGCCAAAAATGCCA
CGGCCTCATCGACGAGGAGCCTTTGCGATTCCGGGGCGAAGTGTACCACG
GCTATCACTTCAGTTGCACGGCCTGCGGCACAGAGTTGGATTCCACTGCT
CGGGAGGTCAAGAGCCGGCCAGGATTGGCTGCTAACGATATGAACGAACT
GTATTGTCTGCGTTGTCACGATAAAATGGGCATTCCCATATGTGGTGCCT
GTCGTCGTCCGATTGAGGAGAGGGTGGTAACGGCGCTCGGAAAGCACTGG
CATGTGGAACATTTCGTGTGCGCCAAGTGCGAGAAACCCTTCTTGGGTCA
CCGACACTACGAGAAGCGGGGATTGGCCTACTGCGAGACGCACTATCATC
AGCTCTTTGGCAACCTGTGCTTCGTCTGCAACCAGGTTATTGGAGGCGAT
GTTTTCACTGCCTTGAACAAGGCCTGGTGTGTGCACCACTTTGCGTGCTC
CGTGTGCGACACGAAGATGACACAAAAATCGAAATTCTACGAGTACGACG
AGAAGCCGGTGTGCAAAAAGTGCTATGACCGATTTCCAAACGAACTCAGA
CGACGTCTGCGCACCGCCCACGAGATGACAATGAAAAAGAACACCTAATG
CCTTGGAGCGAGTCTCAGATCCACACCAAACAGTGCCTTTGTCGTTGTAG
ACCCGCTTTCACTACCATTTTTAACATTTGAGAAACTAAAACCAAACAAA
CTAAAACCTCTTGTGCATGTCCTTTCCGTCTGTTGTAATCCGGTTGTGTG
TAACTTAAATTTTAAATCGAGAATCAACGGCATCAATAGCTAGGGAACAT
AACATTGTGTATTAAAAGCCTTTAACGTTGTTAAAAAAAGAAAAAAAAAA
AAAAA

FI04589.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
stck.d 1743 stck.d 238..1620 1..1383 6915 100 Plus
stck-RB 1844 stck-RB 339..1721 1..1383 6915 100 Plus
stck.f 1964 stck.f 522..1902 3..1383 6905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4185545..4185977 951..1383 2165 100 Plus
chr3R 27901430 chr3R 4184664..4184969 245..550 1530 100 Plus
chr3R 27901430 chr3R 4185222..4185481 692..951 1300 100 Plus
chr3R 27901430 chr3R 4185024..4185165 551..692 710 100 Plus
chr3R 27901430 chr3R 4183348..4183471 1..124 620 100 Plus
chr3R 27901430 chr3R 4184486..4184605 125..244 600 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
stck-RB 1038 CG7954-PB 1..1038 111..1148 5190 100 Plus
stck-RC 1047 CG7954-PC 24..1047 125..1148 5120 100 Plus
stck-RD 1008 CG7954-PD 1..1008 141..1148 5040 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
stck-RB 1388 CG7954-RB 3..1385 1..1383 6915 100 Plus
stck-RD 1500 CG7954-RD 117..1497 3..1383 6905 100 Plus
stck-RA 1380 CG7954-RA 119..1377 125..1383 6295 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
stck-PB 345 CG7954-PB 1..345 111..1145 1971 100 Plus
stck-PC 348 CG7954-PC 9..348 126..1145 1943 100 Plus
stck-PD 335 CG7954-PD 1..335 141..1145 1920 100 Plus
stck-PA 335 CG7954-PA 1..335 141..1145 1920 100 Plus
Pax-PB 556 CG31794-PB 322..553 342..1082 400 32.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8359529..8359961 951..1383 2165 100 Plus
3R 32079331 3R 8358649..8358954 245..550 1530 100 Plus
3R 32079331 3R 8359206..8359465 692..951 1300 100 Plus
3R 32079331 3R 8359009..8359150 551..692 710 100 Plus
3R 32079331 3R 8357333..8357456 1..124 620 100 Plus
3R 32079331 3R 8358471..8358590 125..244 600 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8100360..8100792 951..1383 2165 100 Plus
3R 31820162 3R 8099480..8099785 245..550 1530 100 Plus
3R 31820162 3R 8100037..8100296 692..951 1300 100 Plus
3R 31820162 3R 8099840..8099981 551..692 710 100 Plus
3R 31820162 3R 8098164..8098287 1..124 620 100 Plus
3R 31820162 3R 8099302..8099421 125..244 600 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:27:57 has no hits.

FI04589.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:33:16 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4185546..4185984 952..1390 99   Plus
chr3R 4185223..4185481 693..951 100 -> Plus
chr3R 4185024..4185165 551..692 100 -> Plus
chr3R 4184664..4184969 245..550 100 -> Plus
chr3R 4184486..4184605 125..244 100 -> Plus
chr3R 4183348..4183471 1..124 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:48:45 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 1..1038 111..1148 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:01:55 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 1..1038 111..1148 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:23:19 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 1..1038 111..1148 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:33:16 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 1..1038 111..1148 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:20:28 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 1..1388 3..1390 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:01:55 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 1..1388 3..1390 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:23:19 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 3..1388 1..1386 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-15 12:14:23 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 1..1388 3..1390 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:33:16 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
stck-RB 3..1388 1..1386 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:33:16 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8359530..8359968 952..1390 99   Plus
3R 8359207..8359465 693..951 100 -> Plus
3R 8359009..8359150 551..692 100 -> Plus
3R 8358649..8358954 245..550 100 -> Plus
3R 8358471..8358590 125..244 100 -> Plus
3R 8357333..8357456 1..124 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:23:19 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4185252..4185690 952..1390 99   Plus
arm_3R 4184929..4185187 693..951 100 -> Plus
arm_3R 4184731..4184872 551..692 100 -> Plus
arm_3R 4184371..4184676 245..550 100 -> Plus
arm_3R 4184193..4184312 125..244 100 -> Plus
arm_3R 4183055..4183178 1..124 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:29:30 Download gff for FI04589.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8100361..8100799 952..1390 99   Plus
3R 8100038..8100296 693..951 100 -> Plus
3R 8099840..8099981 551..692 100 -> Plus
3R 8099480..8099785 245..550 100 -> Plus
3R 8099302..8099421 125..244 100 -> Plus
3R 8098164..8098287 1..124 100 -> Plus

FI04589.pep Sequence

Translation from 110 to 1147

> FI04589.pep
MPPVQVQAANMSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCF
RPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHP
QCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLI
DEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCL
RCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY
EKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCD
TKMTQKSKFYEYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKKNT*

FI04589.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16102-PA 348 GF16102-PA 9..348 6..345 1811 98.8 Plus
Dana\GF15196-PA 620 GF15196-PA 363..618 78..325 318 30.1 Plus
Dana\GF22290-PA 178 GF22290-PA 6..176 142..321 249 32.6 Plus
Dana\GF15196-PA 620 GF15196-PA 364..537 143..326 235 33.7 Plus
Dana\GF15196-PA 620 GF15196-PA 374..620 30..267 231 26.9 Plus
Dana\GF15150-PA 178 GF15150-PA 1..176 137..321 226 29 Plus
Dana\GF19820-PA 152 GF19820-PA 5..150 142..299 199 29.7 Plus
Dana\GF22290-PA 178 GF22290-PA 75..178 29..131 192 36.5 Plus
Dana\GF15150-PA 178 GF15150-PA 75..177 29..130 187 35 Plus
Dana\GF22290-PA 178 GF22290-PA 6..121 210..325 160 30.2 Plus
Dana\GF22290-PA 178 GF22290-PA 16..172 29..189 159 25.9 Plus
Dana\GF15150-PA 178 GF15150-PA 7..161 18..178 146 27.2 Plus
Dana\GF15150-PA 178 GF15150-PA 6..119 210..323 143 30.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10588-PA 348 GG10588-PA 7..348 4..345 1827 99.4 Plus
Dere\GG21635-PA 584 GG21635-PA 350..582 78..325 348 32.5 Plus
Dere\GG18228-PA 200 GG18228-PA 28..198 142..321 248 31.5 Plus
Dere\GG21635-PA 584 GG21635-PA 361..584 30..267 240 28 Plus
Dere\GG21514-PA 178 GG21514-PA 1..176 137..321 231 30.1 Plus
Dere\GG22918-PA 175 GG22918-PA 5..174 142..321 231 29.4 Plus
Dere\GG21635-PA 584 GG21635-PA 419..582 29..206 208 29.1 Plus
Dere\GG21514-PA 178 GG21514-PA 75..177 29..130 189 35 Plus
Dere\GG18228-PA 200 GG18228-PA 97..200 29..131 185 35.6 Plus
Dere\GG18228-PA 200 GG18228-PA 7..143 189..325 169 27.7 Plus
Dere\GG18228-PA 200 GG18228-PA 38..194 29..189 155 26.5 Plus
Dere\GG21514-PA 178 GG21514-PA 6..121 210..325 144 29.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14398-PA 348 GH14398-PA 9..348 6..345 1782 96.8 Plus
Dgri\GH13469-PA 585 GH13469-PA 351..583 78..325 349 32.5 Plus
Dgri\GH12803-PA 179 GH12803-PA 7..177 142..321 263 33.7 Plus
Dgri\GH13469-PA 585 GH13469-PA 362..585 30..267 236 27.6 Plus
Dgri\GH10298-PA 189 GH10298-PA 16..187 141..321 219 29.1 Plus
Dgri\GH13469-PA 585 GH13469-PA 420..583 29..206 208 29.1 Plus
Dgri\GH20594-PA 1166 GH20594-PA 990..1164 77..261 206 29.6 Plus
Dgri\GH12803-PA 179 GH12803-PA 40..179 3..131 182 28.6 Plus
Dgri\GH10298-PA 189 GH10298-PA 26..172 28..178 180 29.6 Plus
Dgri\GH10298-PA 189 GH10298-PA 75..188 19..130 179 33.3 Plus
Dgri\GH12803-PA 179 GH12803-PA 1..175 11..191 162 26.9 Plus
Dgri\GH10298-PA 189 GH10298-PA 18..130 211..323 149 33.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
stck-PB 345 CG7954-PB 1..345 1..345 1971 100 Plus
stck-PC 348 CG7954-PC 9..348 6..345 1943 100 Plus
stck-PD 335 CG7954-PD 1..335 11..345 1920 100 Plus
stck-PA 335 CG7954-PA 1..335 11..345 1920 100 Plus
Pax-PB 556 CG31794-PB 322..553 78..324 400 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10041-PA 348 GI10041-PA 9..348 6..345 1776 96.2 Plus
Dmoj\GI17221-PA 605 GI17221-PA 371..603 78..325 349 32.5 Plus
Dmoj\GI15958-PA 179 GI15958-PA 7..179 142..323 251 32.2 Plus
Dmoj\GI17221-PA 605 GI17221-PA 382..605 30..267 237 27.6 Plus
Dmoj\GI17994-PA 183 GI17994-PA 11..181 142..321 233 29.8 Plus
Dmoj\GI17221-PA 605 GI17221-PA 440..603 29..206 209 29.1 Plus
Dmoj\GI19738-PA 1709 GI19738-PA 1533..1707 77..261 205 29.6 Plus
Dmoj\GI15958-PA 179 GI15958-PA 76..178 29..130 196 37.9 Plus
Dmoj\GI17994-PA 183 GI17994-PA 80..182 29..130 188 35.9 Plus
Dmoj\GI17994-PA 183 GI17994-PA 11..124 210..323 156 34.2 Plus
Dmoj\GI15958-PA 179 GI15958-PA 1..173 11..189 155 25.6 Plus
Dmoj\GI17994-PA 183 GI17994-PA 20..166 28..178 146 26.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24193-PA 348 GL24193-PA 9..348 6..345 1800 98.2 Plus
Dper\GL21108-PA 639 GL21108-PA 387..637 78..325 322 31.5 Plus
Dper\GL25856-PA 177 GL25856-PA 1..176 137..321 238 30.9 Plus
Dper\GL21108-PA 639 GL21108-PA 398..639 30..267 235 27.4 Plus
Dper\GL11647-PA 185 GL11647-PA 5..174 142..321 205 30 Plus
Dper\GL21108-PA 639 GL21108-PA 456..637 29..206 196 28.4 Plus
Dper\GL20860-PA 340 GL20860-PA 96..319 15..246 195 26.9 Plus
Dper\GL25856-PA 177 GL25856-PA 39..177 3..130 189 31.7 Plus
Dper\GL11647-PA 185 GL11647-PA 61..185 17..139 171 31.2 Plus
Dper\GL25856-PA 177 GL25856-PA 15..161 28..178 149 26.3 Plus
Dper\GL25856-PA 177 GL25856-PA 6..121 210..325 146 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20717-PC 345 GA20717-PC 1..345 1..345 1836 98.8 Plus
Dpse\GA20717-PA 348 GA20717-PA 9..348 6..345 1810 98.8 Plus
Dpse\GA20717-PB 335 GA20717-PB 1..335 11..345 1783 99.1 Plus
Dpse\GA16481-PA 632 GA16481-PA 380..630 78..325 322 31.5 Plus
Dpse\GA16596-PA 177 GA16596-PA 1..176 137..321 238 30.9 Plus
Dpse\GA16481-PA 632 GA16481-PA 391..632 30..267 234 27.4 Plus
Dpse\GA16481-PA 632 GA16481-PA 449..630 29..206 196 28.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:10:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23732-PA 348 GM23732-PA 7..348 4..345 1828 99.4 Plus
Dsec\GM17013-PA 581 GM17013-PA 347..579 78..325 348 32.5 Plus
Dsec\GM17013-PA 581 GM17013-PA 358..581 30..267 240 28 Plus
Dsec\GM13370-PA 209 GM13370-PA 37..209 142..323 234 31.1 Plus
Dsec\GM22049-PA 178 GM22049-PA 1..176 137..321 227 29.6 Plus
Dsec\GM23266-PA 178 GM23266-PA 1..176 137..321 227 29.6 Plus
Dsec\GM17013-PA 581 GM17013-PA 416..579 29..206 208 29.1 Plus
Dsec\GM13370-PA 209 GM13370-PA 106..208 29..130 198 36.9 Plus
Dsec\GM22049-PA 178 GM22049-PA 75..177 29..130 194 35.9 Plus
Dsec\GM13370-PA 209 GM13370-PA 48..203 30..189 169 28 Plus
Dsec\GM22049-PA 178 GM22049-PA 6..121 210..325 158 31 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18542-PA 348 GD18542-PA 9..348 6..345 1828 100 Plus
Dsim\GD21763-PA 678 GD21763-PA 416..676 29..325 316 28 Plus
Dsim\GD21763-PA 678 GD21763-PA 348..458 211..322 239 42 Plus
Dsim\GD21763-PA 678 GD21763-PA 348..530 143..334 238 33.2 Plus
Dsim\GD15732-PA 209 GD15732-PA 37..209 142..323 231 31.1 Plus
Dsim\GD17716-PA 178 GD17716-PA 1..176 137..321 227 29.6 Plus
Dsim\GD21644-PA 178 GD21644-PA 1..176 137..321 227 29.6 Plus
Dsim\GD15732-PA 209 GD15732-PA 106..208 29..130 198 36.9 Plus
Dsim\GD17716-PA 178 GD17716-PA 75..177 29..130 194 35.9 Plus
Dsim\GD15732-PA 209 GD15732-PA 48..203 30..189 170 28 Plus
Dsim\GD17716-PA 178 GD17716-PA 6..121 210..325 158 31 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22568-PA 348 GJ22568-PA 9..348 6..345 1785 97.1 Plus
Dvir\GJ17978-PA 597 GJ17978-PA 363..595 78..325 350 32.5 Plus
Dvir\GJ19592-PA 181 GJ19592-PA 2..179 135..321 242 30.3 Plus
Dvir\GJ17978-PA 597 GJ17978-PA 374..597 30..267 236 27.6 Plus
Dvir\GJ17978-PA 597 GJ17978-PA 432..595 29..206 209 29.1 Plus
Dvir\GJ18448-PA 1587 GJ18448-PA 1411..1585 77..261 207 29.6 Plus
Dvir\GJ18448-PA 1587 GJ18448-PA 1412..1583 142..319 199 30 Plus
Dvir\GJ19592-PA 181 GJ19592-PA 78..180 29..130 190 35.9 Plus
Dvir\GJ12349-PA 335 GJ12349-PA 91..314 15..246 189 26.5 Plus
Dvir\GJ18448-PA 1587 GJ18448-PA 1425..1572 32..180 181 31.2 Plus
Dvir\GJ19592-PA 181 GJ19592-PA 9..122 210..323 156 33.3 Plus
Dvir\GJ19592-PA 181 GJ19592-PA 18..164 28..178 150 26.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:10:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13878-PA 348 GK13878-PA 9..348 6..345 1805 98.2 Plus
Dwil\GK22266-PA 169 GK22266-PA 20..169 171..320 723 88 Plus
Dwil\GK16085-PA 290 GK16085-PA 169..254 195..280 431 87.2 Plus
Dwil\GK23838-PA 630 GK23838-PA 373..628 78..325 315 30.9 Plus
Dwil\GK15192-PA 177 GK15192-PA 1..176 137..321 243 28.5 Plus
Dwil\GK23838-PA 630 GK23838-PA 374..547 143..326 231 33.7 Plus
Dwil\GK23838-PA 630 GK23838-PA 384..630 30..267 227 26.9 Plus
Dwil\GK22266-PA 169 GK22266-PA 69..154 29..114 150 34.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:10:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25876-PA 348 GE25876-PA 9..347 6..344 1817 99.7 Plus
Dyak\GE12653-PA 581 GE12653-PA 347..579 78..325 348 32.5 Plus
Dyak\GE15647-PA 179 GE15647-PA 7..177 142..321 256 32.6 Plus
Dyak\GE12653-PA 581 GE12653-PA 358..581 30..267 240 28 Plus
Dyak\GE12993-PA 178 GE12993-PA 1..176 137..321 232 30.1 Plus
Dyak\GE14355-PA 187 GE14355-PA 5..184 142..329 224 28.9 Plus
Dyak\GE12653-PA 581 GE12653-PA 416..579 29..206 208 29.1 Plus
Dyak\GE12993-PA 178 GE12993-PA 75..177 29..130 188 35 Plus
Dyak\GE15647-PA 179 GE15647-PA 76..179 29..131 186 35.6 Plus
Dyak\GE15647-PA 179 GE15647-PA 5..122 208..325 166 30.5 Plus
Dyak\GE15647-PA 179 GE15647-PA 1..173 11..189 152 25.6 Plus
Dyak\GE12993-PA 178 GE12993-PA 6..121 210..325 144 29.3 Plus

FI04589.hyp Sequence

Translation from 110 to 1147

> FI04589.hyp
MPPVQVQAANMSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCF
RPFQDGIFYEFEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHP
QCFRCQLCAKELADCGFIKNQNRALCHECNAKVKAEITGRYVCQKCHGLI
DEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLAANDMNELYCL
RCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY
EKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCD
TKMTQKSKFYEYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKKNT*

FI04589.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
stck-PB 345 CG7954-PB 1..345 1..345 1971 100 Plus
stck-PC 348 CG7954-PC 9..348 6..345 1943 100 Plus
stck-PD 335 CG7954-PD 1..335 11..345 1920 100 Plus
stck-PA 335 CG7954-PA 1..335 11..345 1920 100 Plus
Pax-PB 556 CG31794-PB 322..553 78..324 400 32.7 Plus