Clone FI04601 Report

Search the DGRC for FI04601

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:46
Well:1
Vector:pFlc-1
Associated Gene/TranscriptCG5116-RA
Protein status:FI04601.pep: gold
Sequenced Size:2392

Clone Sequence Records

FI04601.complete Sequence

2392 bp assembled on 2009-06-22

GenBank Submission: BT088847.1

> FI04601.complete
AATTGCATAATAATTGCTCAAACTACAGGTTTTTCCGGCACCTATTTCGC
CCAGAAGATAGTACAATCAAAAATTCGCTACCCAATCAAGTACAACATAC
TTATCTCCTCACTGGTGGCCACCGGCGTGTCCTACCAAATCACATCGACA
CGGACTAAAGCCTGCCAAGCGGCGTGGATGGCCTTTGAGGACAAGCATTC
GGTGCTCAAAGAGAAAACCTTTTAACACCTTCAAAATTCCATTTAGCTTT
AGTCATGTCTGCTCTACGAATATTGGCCCGATTTGTCAGCACTAGGACTC
TGCGAATTCGTCCGATTCTGGAGATTCCCGCACGCTGCAAGTACACCCAA
CATCAAGGAGTTAAGGGCATTCGGAACAGGAAGAGCTTCTTCGAAGCCCA
AATTCAGGCAGGTCAACAAGGTGAGGAGGATGCGGACTTAGAGCGGACAG
CCAATAGCGATCTGGCGGATATGCGGTTCTTGGATGATCGAGCCTACGAC
GAGGTGGCTGGAGGAGCCATGAGAATCACACGTGACATAGCCAGCTCTCA
GCAGGTGCTCATCCTCCAACCGTATGTAAAATGGGCAGCCAAACGACAGA
ACGCACCCGTCGATGTTCGGCCCGAGGATCAACTCGCGGAGGCCACAGCG
CTGATCCACTCCCTGCCCAATTGGCAGGTGGCCAGGGCATTAAAGGTTCC
CCTCGAAAGCCTCGAAAAGAAGACGCTTTTCGGCAGCGGCAAGCTGGTGG
AACTCAAGGAACTGGTCGCCGAATTGCGGCAGGAACGGCATCTAACTTGC
CTGTTTGTCAGCAAGGGGACACTATCATTCGCCCAAAAACGTTTCCTGGA
GGCGGAGTTTCGCCTGCCAGTAATGGATCGCTATTCCGTTGTTATACAGA
TACTAAGACTGCATGCCACCAGCGCCGAAGCAAAACTGCAGGTAGCCATG
GCTGAACTTCCTTACATTTGGGCGCAGGCTAAGGATGCCAGTGTTACGCA
GACGCGTCGTCAGGGCTACGCCTTGACCGATCTGCAGAAGGAGATTCTGC
GAACCAGGGAGCGAAAGTTGCGAGCGGAATTAGATCGTGTCCGGCGACAG
AGGCAGTTGCTTCGCCAGAAAAGAAAACAGCAAAATTATCCCATCGTTGC
AGTGGTGGGTTACACAAATGCTGGCAAGACTTCCTTGATCAAGGCACTCA
CAGTCGAGGATGCACTGCAGCCCAGGAATCAGTTGTTCGCAACGCTTGAT
GTGACTGCTCATGCTGGTTGTTTGCCATGCAATCTGGAGGTGATCTATAT
GGACACGGTGGGCTTTATGTCCGATCTGCCAACGGGACTGTTTGAATGCT
TTGTGGCCACTTTGGAGGATGCCATGCTGGCGGATGTAATAGTCCACGTC
CAGGATCTTTCCCATCCGTGTCACGCTGCTCAACGCAGCCATGTGGAGGC
CACGCTTCGTTCTTTGGCATTCAACGTGGCTGGCGGAGATTCCACGGCCA
GCCAGTTGCCGCCGATCATTAATGTGTACAACAAATGTGATCTTGTTTCC
CAAGAGGCTCAGTCGTCTGCAGACCCAGTGCATCATATATCAGCCAGAGC
ACAGACTGGGCTGGAACCCCTGCTAGATGACATCGAGCAACAGATATTGA
CCGCCACCGGGCGAAGAAAACTTCAGATGCGAGTGCCCAGCGGCGGTCCA
GAAATGGCTTGGCTGTACAAAAACGCAGCTGTGGTGGAAACGACAGCGGA
TGCGGAGAATCCCGAACGCCTCATGATGCACGTGGTTATCAGCCAACGCA
CACTGGATCAGTTCAAGCGACAGTTTTGCCGATGAATTTAAAGTGCCATG
GATAAATATCTGAGGCGCAACTGGCACCGACTAAATGTTTATTATTGCTC
TCGTTTTTTTTGTTGGTTTATTAGCGGGTGTAGTTAGGACTGGTTTTCTT
TTCTTGTTTTAAATTCTATACAAATATAAAAGTATCTGCCGAAAACTAAA
ACGAAACAATCTCTAAAAATATTTTTTAACATAATATTTGTATTGTATTG
CACTTCTCTGACATTTTTGTGCTGTGGTTTTCTCTAGGAATAATCGAAAC
TAAACCCTTGTGGGATCAGTTTTCGCATCAACCATTTTTGTTTATATAAC
TAGGGCAAGTTTTTTTTATTTATTTTTCTTTGTGTGGTGCTGACTTCTCT
ATTGGCACAATGGAATATTTAAAAATAATGCAGGGTTGATGAGCATAAAC
AACTTAAAATACAGAAACTGAAACAAACTTAACACCAGCTTAAACCTAAA
GTAACTTAAAATTAAACAAAAATGCGTTCAACACTCTAGTGTACAAATTA
AAAACCCATTTATGCGTGTGAAAATTGAAAAAAAAAAAAAAA

FI04601.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG5116-RA 2377 CG5116-RA 1..2377 1..2377 11885 100 Plus
Dhap-at.a 3245 Dhap-at.a 3007..3245 2378..2140 1195 100 Minus
Dhap-at-RA 3278 Dhap-at-RA 3040..3278 2378..2140 1195 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 22:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21307988..21308983 1382..2377 4980 100 Plus
chr3R 27901430 chr3R 21306437..21306926 1..490 2420 99.6 Plus
chr3R 27901430 chr3R 21307487..21307930 940..1383 2190 99.5 Plus
chr3R 27901430 chr3R 21306979..21307432 490..943 2150 98.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG5116-RB 1581 CG5116-PB 1..1581 255..1835 7905 100 Plus
CG5116-RA 1581 CG5116-PA 1..1581 255..1835 7905 100 Plus
CG42488-RB 312 CG42488-PB 116..312 29..225 985 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:26 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG5116-RA 2380 CG5116-RA 4..2380 1..2377 11885 100 Plus
CG42488-RB 2158 CG42488-RB 184..2158 29..2003 9875 100 Plus
CG5116-RB 2158 CG5116-RB 184..2158 29..2003 9875 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG5116-PB 526 CG5116-PB 1..526 255..1832 2437 100 Plus
CG5116-PA 526 CG5116-PA 1..526 255..1832 2437 100 Plus
CG42488-PB 103 CG42488-PB 40..103 31..222 325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25484860..25485856 1382..2378 4985 100 Plus
3R 32079331 3R 25483308..25483797 1..490 2450 100 Plus
3R 32079331 3R 25483851..25484304 490..943 2270 100 Plus
3R 32079331 3R 25484359..25484802 940..1383 2220 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25225691..25226687 1382..2378 4985 100 Plus
3R 31820162 3R 25224139..25224628 1..490 2450 100 Plus
3R 31820162 3R 25224682..25225135 490..943 2270 100 Plus
3R 31820162 3R 25225190..25225633 940..1383 2220 100 Plus
Blast to na_te.dros performed 2014-11-26 22:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Damb\P-element_T 3329 Damb\P-element_T P_T 3329bp Derived from AF012414. 1881..2037 2376..2226 122 57.9 Minus

FI04601.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:18:09 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21307989..21308983 1383..2377 100   Plus
chr3R 21307489..21307929 942..1382 99 -> Plus
chr3R 21306980..21307430 491..941 98 -> Plus
chr3R 21306437..21306926 1..490 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:50 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
CG5116-RA 1..1581 255..1835 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:48:32 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
CG5116-RA 1..1581 255..1835 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:26:33 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
CG5116-RA 1..1581 255..1835 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:18:09 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
CG5116-RA 1..1581 255..1835 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-22 09:53:16 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
CG5116-RA 1..2377 1..2377 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:48:32 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
CG5116-RA 1..2377 1..2377 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:26:33 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
CG5116-RA 4..2380 1..2377 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:18:09 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
CG5116-RA 4..2380 1..2377 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:18:09 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25484861..25485855 1383..2377 100   Plus
3R 25484361..25484801 942..1382 100 -> Plus
3R 25483852..25484302 491..941 100 -> Plus
3R 25483308..25483797 1..490 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:26:33 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21310583..21311577 1383..2377 100   Plus
arm_3R 21310083..21310523 942..1382 100 -> Plus
arm_3R 21309574..21310024 491..941 100 -> Plus
arm_3R 21309030..21309519 1..490 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:24:09 Download gff for FI04601.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25225692..25226686 1383..2377 100   Plus
3R 25225192..25225632 942..1382 100 -> Plus
3R 25224683..25225133 491..941 100 -> Plus
3R 25224139..25224628 1..490 100 -> Plus

FI04601.pep Sequence

Translation from 254 to 1834

> FI04601.pep
MSALRILARFVSTRTLRIRPILEIPARCKYTQHQGVKGIRNRKSFFEAQI
QAGQQGEEDADLERTANSDLADMRFLDDRAYDEVAGGAMRITRDIASSQQ
VLILQPYVKWAAKRQNAPVDVRPEDQLAEATALIHSLPNWQVARALKVPL
ESLEKKTLFGSGKLVELKELVAELRQERHLTCLFVSKGTLSFAQKRFLEA
EFRLPVMDRYSVVIQILRLHATSAEAKLQVAMAELPYIWAQAKDASVTQT
RRQGYALTDLQKEILRTRERKLRAELDRVRRQRQLLRQKRKQQNYPIVAV
VGYTNAGKTSLIKALTVEDALQPRNQLFATLDVTAHAGCLPCNLEVIYMD
TVGFMSDLPTGLFECFVATLEDAMLADVIVHVQDLSHPCHAAQRSHVEAT
LRSLAFNVAGGDSTASQLPPIINVYNKCDLVSQEAQSSADPVHHISARAQ
TGLEPLLDDIEQQILTATGRRKLQMRVPSGGPEMAWLYKNAAVVETTADA
ENPERLMMHVVISQRTLDQFKRQFCR*

FI04601.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17695-PA 523 GF17695-PA 1..523 1..525 2297 84.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11408-PA 525 GG11408-PA 1..525 1..526 2570 94.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18978-PA 519 GH18978-PA 15..519 17..525 2251 82.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5116-PB 526 CG5116-PB 1..526 1..526 2655 100 Plus
CG5116-PA 526 CG5116-PA 1..526 1..526 2655 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22404-PA 522 GI22404-PA 1..522 1..525 1993 73.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22142-PA 525 GL22142-PA 1..524 1..524 2312 86.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18671-PA 525 GA18671-PA 1..524 1..524 2317 85.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10247-PA 526 GM10247-PA 1..526 1..526 2652 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21220-PA 526 GD21220-PA 1..526 1..526 2670 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10964-PA 525 GJ10964-PA 15..525 17..525 2189 79.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13306-PA 523 GK13306-PA 14..523 19..525 2106 77.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:00:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23604-PA 528 GE23604-PA 1..528 1..526 2597 95.3 Plus

FI04601.hyp Sequence

Translation from 254 to 1834

> FI04601.hyp
MSALRILARFVSTRTLRIRPILEIPARCKYTQHQGVKGIRNRKSFFEAQI
QAGQQGEEDADLERTANSDLADMRFLDDRAYDEVAGGAMRITRDIASSQQ
VLILQPYVKWAAKRQNAPVDVRPEDQLAEATALIHSLPNWQVARALKVPL
ESLEKKTLFGSGKLVELKELVAELRQERHLTCLFVSKGTLSFAQKRFLEA
EFRLPVMDRYSVVIQILRLHATSAEAKLQVAMAELPYIWAQAKDASVTQT
RRQGYALTDLQKEILRTRERKLRAELDRVRRQRQLLRQKRKQQNYPIVAV
VGYTNAGKTSLIKALTVEDALQPRNQLFATLDVTAHAGCLPCNLEVIYMD
TVGFMSDLPTGLFECFVATLEDAMLADVIVHVQDLSHPCHAAQRSHVEAT
LRSLAFNVAGGDSTASQLPPIINVYNKCDLVSQEAQSSADPVHHISARAQ
TGLEPLLDDIEQQILTATGRRKLQMRVPSGGPEMAWLYKNAAVVETTADA
ENPERLMMHVVISQRTLDQFKRQFCR*

FI04601.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5116-PB 526 CG5116-PB 1..526 1..526 2655 100 Plus
CG5116-PA 526 CG5116-PA 1..526 1..526 2655 100 Plus