Clone FI04632 Report

Search the DGRC for FI04632

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:46
Well:32
Vector:pFlc-1
Associated Gene/Transcriptnrv3-RA
Protein status:FI04632.pep: gold
Sequenced Size:1691

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
nrv3 2008-12-18 5.12 accounting

Clone Sequence Records

FI04632.complete Sequence

1691 bp assembled on 2008-09-15

GenBank Submission: BT044501.1

> FI04632.complete
GGTTCCAGCGCCAACTCGCATAGCCCTCAGCTGAGCGGAAAGCTATGTGC
GCGAGGAGAGCTTAAGCCCACCGCCCCCATACGCAGCTGGCGGCACACAC
CCCCTTAGAACGACGAAACTGCCCGGAGCCGAATACGAGTGCGAGCCGAA
CCATTGTCGATATGCCTGGTGGAAGTTGCGGCGACGATGGCACTATCATT
GGCGTTTTAACTGTGGACGGTTGCTACTCGCACTCGCTGGCGGATTAACG
GCATAAATATTTAAATAGATATATGTATTTCGCATACATATATACCGTTA
TATCTGGAGCTACTATGTACTAGTAGAGGGGAAGCGTTTGAAGACGAAAA
AAATTTCATTCTTAACGATTCACATTAAATGCAAGTCACAACAATACTAT
GGTTACAGACGTTTAAAAATATATAAAAAAAATTTTGCACCAGAACAGTT
GATAAAAGAAACTTAAAATAACGACTTAAAACAAAAATAAATTCGAAATA
ATTCAACTTGAAAGACAATACGCCCATCAACACACTACAAAGTTAAAATG
GCCGATAAAAAAATTGGTGAATACTATGCACCACCTGTGAAAATGGGCAA
ATGGGAGGGTTTCAAAAAATTCCTATGGAACAGTGAAACTAGCCAATGCC
TTGGACGCACCGGATCCAGTTGGGCGAAAATTCTCCTATTTTACATAATT
TTTTATGCGGCGTTAACTGGTTTTTTTGCTGCAATTTTCACTGTATTTTA
TCAAACTTTGGACAATGAAAAGCCAAAATGGATGCTTGACAATGGTTTGA
TAGGGTCCAACCCAGGTCTAGGCTTTCGACCAATGCCACCGGAAGCGAAT
GTTGAGAGCACATTAGTTTGGTACGAGTCATCAAAGAAGGATAACTATAA
GTACTGGGTGGACGAGACTTCACGTTTTCTGAAATCGTACCAAGATCTTG
AGAAGCAAAATCAAGTGAACTGTAGCTTTGAACATCCACCACAAGACGAC
AAGGTCTGCGGCATTGACTTCTCCAGCTTCTCGCCATGTACAGCTGACAA
CAACTTTGGCTACCACGTTGCCCGGCCATGTATATTCCTTAAGTTGAATA
AGATTTACAATTGGATACCAGAAATTTACAACGATTCTAAGACTTTGCCA
GATCATATGCCAGAGGAACTAAAACAGCACATCAAGGAAAAGCAAAGTCT
TAGGCCCAATGAAACAAATGTAGTTTGGGTCTCGTGCGAGGGAGAAAATC
CCGCTGATGTAGAGAACATAAAAGCACGCGACTACTATCCCCGAATGGGA
TTTCCTCGTTACTATTTTCCGTTTAAAAACATTCAGGGATATATACCGCC
CATTGTTGCTGTTCAATTTACCGTTGAAACCGGCGTTTTGATCAACATTG
AATGTAAAGCTTGGGCCCGCAACATTAATCACGACCGTTCAGACAGAAGA
GGATCCGTTCACTTCGAGTTGATGGTTGATTAAGAGAGTCGTTGGGAAGA
TGTCATTGGAGAGAAGAGATCGGCCGTATTATAAAGTGGGCATCAAAAAA
TAAATGAGAAAATAAAATAAAGGAATGGAATATAGAAAAAAAAAACTGAC
AACAAAACCCACACAGAATAGATACGAGAAAAATGTAGTAGCGCAGAAAC
GTCAGGTTAAAGCAAAAACAAAAACAAAAAAAAAAAAAAAA

FI04632.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
nrv3.f 2147 nrv3.f 50..1739 2..1691 8420 99.8 Plus
nrv3.i 3795 nrv3.i 50..1739 2..1691 8420 99.8 Plus
nrv3.k 3080 nrv3.k 50..1739 2..1691 8420 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 21378517..21378877 2..362 1790 99.7 Plus
chr2L 23010047 chr2L 21380534..21380845 363..674 1560 100 Plus
chr2L 23010047 chr2L 21388542..21388837 1380..1675 1480 100 Plus
chr2L 23010047 chr2L 21386993..21387159 936..1102 835 100 Plus
chr2L 23010047 chr2L 21387404..21387569 1214..1379 815 99.4 Plus
chr2L 23010047 chr2L 21382969..21383112 674..817 720 100 Plus
chr2L 23010047 chr2L 21383790..21383912 813..935 615 100 Plus
chr2L 23010047 chr2L 21387220..21387332 1101..1213 565 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
nrv3-RD 936 CG8663-PD 1..936 548..1483 4665 99.9 Plus
nrv3-RC 936 CG8663-PC 1..936 548..1483 4665 99.9 Plus
nrv3-RA 936 CG8663-PA 1..936 548..1483 4665 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:31 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
nrv3-RC 1675 CG8663-RC 2..1675 2..1675 8355 99.9 Plus
nrv3-RD 4514 CG8663-RD 1..1542 134..1675 7695 99.9 Plus
nrv3-RE 4637 CG8663-RE 347..1665 363..1675 6455 99.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
nrv3-PD 311 CG8663-PD 1..311 548..1480 1716 100 Plus
nrv3-PC 311 CG8663-PC 1..311 548..1480 1716 100 Plus
nrv3-PA 311 CG8663-PA 1..311 548..1480 1716 100 Plus
nrv3-PE 313 CG8663-PE 1..313 548..1480 1700 99 Plus
nrv2-PG 323 CG9261-PG 14..323 569..1480 884 50.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21380001..21380361 2..362 1805 100 Plus
2L 23513712 2L 21382019..21382330 363..674 1560 100 Plus
2L 23513712 2L 21390052..21390363 1380..1691 1545 99.7 Plus
2L 23513712 2L 21388503..21388669 936..1102 835 100 Plus
2L 23513712 2L 21388914..21389079 1214..1379 815 99.4 Plus
2L 23513712 2L 21384454..21384597 674..817 720 100 Plus
2L 23513712 2L 21385275..21385397 813..935 615 100 Plus
2L 23513712 2L 21388730..21388842 1101..1213 565 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21380001..21380361 2..362 1805 100 Plus
2L 23513712 2L 21382019..21382330 363..674 1560 100 Plus
2L 23513712 2L 21390052..21390363 1380..1691 1545 99.6 Plus
2L 23513712 2L 21388503..21388669 936..1102 835 100 Plus
2L 23513712 2L 21388914..21389079 1214..1379 815 99.3 Plus
2L 23513712 2L 21384454..21384597 674..817 720 100 Plus
2L 23513712 2L 21385275..21385397 813..935 615 100 Plus
2L 23513712 2L 21388730..21388842 1101..1213 565 100 Plus
Blast to na_te.dros performed 2014-11-27 00:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 731..859 1541..1673 159 60.9 Plus

FI04632.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:57:27 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21388542..21388820 1380..1658 100   Plus
chr2L 21387404..21387569 1214..1379 99 -> Plus
chr2L 21387222..21387332 1103..1213 100 -> Plus
chr2L 21386993..21387159 936..1102 100 -> Plus
chr2L 21383793..21383912 816..935 100 -> Plus
chr2L 21382970..21383110 675..815 100 -> Plus
chr2L 21380534..21380845 363..674 91 -> Plus
chr2L 21378516..21378877 1..362 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:42:29 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RD 1..936 548..1483 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:09:21 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RD 1..936 548..1483 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:33:35 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RC 1..936 548..1483 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:57:27 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RA 1..936 548..1483 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:42:29 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RC 2..1675 2..1675 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:09:21 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RC 2..1675 2..1675 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:33:35 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RC 2..1675 2..1675 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-15 12:13:21 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RC 2..1675 2..1675 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:57:27 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
nrv3-RC 2..1675 2..1675 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:57:27 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21390052..21390347 1380..1675 100   Plus
2L 21388914..21389079 1214..1379 99 -> Plus
2L 21388732..21388842 1103..1213 100 -> Plus
2L 21388503..21388669 936..1102 100 -> Plus
2L 21385278..21385397 816..935 100 -> Plus
2L 21384455..21384595 675..815 100 -> Plus
2L 21382019..21382330 363..674 100 -> Plus
2L 21380000..21380361 1..362 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:33:35 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21390052..21390347 1380..1675 100   Plus
arm_2L 21388914..21389079 1214..1379 99 -> Plus
arm_2L 21388732..21388842 1103..1213 100 -> Plus
arm_2L 21388503..21388669 936..1102 100 -> Plus
arm_2L 21385278..21385397 816..935 100 -> Plus
arm_2L 21384455..21384595 675..815 100 -> Plus
arm_2L 21382019..21382330 363..674 100 -> Plus
arm_2L 21380000..21380361 1..362 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:39:10 Download gff for FI04632.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21390052..21390347 1380..1675 100   Plus
2L 21388914..21389079 1214..1379 99 -> Plus
2L 21388732..21388842 1103..1213 100 -> Plus
2L 21388503..21388669 936..1102 100 -> Plus
2L 21385278..21385397 816..935 100 -> Plus
2L 21384455..21384595 675..815 100 -> Plus
2L 21382019..21382330 363..674 100 -> Plus
2L 21380000..21380361 1..362 99 -> Plus

FI04632.pep Sequence

Translation from 547 to 1482

> FI04632.pep
MADKKIGEYYAPPVKMGKWEGFKKFLWNSETSQCLGRTGSSWAKILLFYI
IFYAALTGFFAAIFTVFYQTLDNEKPKWMLDNGLIGSNPGLGFRPMPPEA
NVESTLVWYESSKKDNYKYWVDETSRFLKSYQDLEKQNQVNCSFEHPPQD
DKVCGIDFSSFSPCTADNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTL
PDHMPEELKQHIKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPRM
GFPRYYFPFKNIQGYIPPIVAVQFTVETGVLINIECKAWARNINHDRSDR
RGSVHFELMVD*

FI04632.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14332-PA 311 GF14332-PA 1..311 1..311 1591 94.2 Plus
Dana\GF14479-PA 323 GF14479-PA 14..323 8..311 873 51.3 Plus
Dana\GF14480-PA 309 GF14480-PA 11..309 7..311 619 39.9 Plus
Dana\GF18471-PA 386 GF18471-PA 34..273 24..308 214 25.8 Plus
Dana\GF18470-PA 313 GF18470-PA 41..294 35..305 182 25.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21302-PA 311 GG21302-PA 1..311 1..311 1683 100 Plus
Dere\GG21303-PA 204 GG21303-PA 23..204 130..311 985 98.9 Plus
Dere\GG23580-PA 323 GG23580-PA 14..323 8..311 864 50.3 Plus
Dere\GG23582-PA 309 GG23582-PA 11..309 7..311 596 38 Plus
Dere\GG16108-PA 345 GG16108-PA 34..275 24..311 172 22.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13318-PA 311 GH13318-PA 1..311 1..311 1501 89.1 Plus
Dgri\GH10786-PA 323 GH10786-PA 14..323 8..311 863 49.7 Plus
Dgri\GH10787-PA 309 GH10787-PA 8..309 2..311 582 37.4 Plus
Dgri\GH22397-PA 277 GH22397-PA 34..274 24..308 189 25.7 Plus
Dgri\GH22396-PA 310 GH22396-PA 140..282 164..293 155 33.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
nrv3-PD 311 CG8663-PD 1..311 1..311 1716 100 Plus
nrv3-PC 311 CG8663-PC 1..311 1..311 1716 100 Plus
nrv3-PA 311 CG8663-PA 1..311 1..311 1716 100 Plus
nrv3-PE 313 CG8663-PE 1..313 1..311 1700 99 Plus
nrv2-PG 323 CG9261-PG 14..323 8..311 884 50.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12264-PA 310 GI12264-PA 1..310 1..311 1483 87.5 Plus
Dmoj\GI17298-PA 323 GI17298-PA 14..323 8..311 874 51 Plus
Dmoj\GI17299-PA 309 GI17299-PA 19..309 17..311 598 39.3 Plus
Dmoj\GI16930-PA 276 GI16930-PA 34..271 24..308 195 24 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26665-PA 311 GL26665-PA 1..311 1..311 1578 92.6 Plus
Dper\GL25960-PA 323 GL25960-PA 14..323 8..311 882 51.6 Plus
Dper\GL25961-PA 309 GL25961-PA 8..309 2..311 566 36.4 Plus
Dper\GL25223-PA 321 GL25223-PA 33..321 24..311 467 35.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21243-PA 311 GA21243-PA 1..311 1..311 1578 92.6 Plus
Dpse\GA21652-PA 323 GA21652-PA 14..323 8..311 881 51.6 Plus
Dpse\GA21650-PA 309 GA21650-PA 8..309 2..311 565 36.4 Plus
Dpse\GA22950-PA 321 GA22950-PA 33..321 24..311 463 35.4 Plus
Dpse\GA11151-PA 623 GA11151-PA 32..276 22..310 152 24.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23414-PA 311 GM23414-PA 1..311 1..311 1683 100 Plus
Dsec\GM13825-PA 323 GM13825-PA 14..323 8..311 859 50.3 Plus
Dsec\GM13836-PA 309 GM13836-PA 11..309 7..311 595 38 Plus
Dsec\GM26920-PA 347 GM26920-PA 34..261 24..296 197 24.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22540-PA 340 GD22540-PA 14..340 8..311 830 46.5 Plus
Dsim\GD22541-PA 309 GD22541-PA 11..309 7..311 601 38.3 Plus
Dsim\GD20125-PA 347 GD20125-PA 34..288 24..308 204 24.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17853-PA 311 GJ17853-PA 1..311 1..311 1525 89.1 Plus
Dvir\GJ15658-PA 323 GJ15658-PA 14..323 8..311 862 50.6 Plus
Dvir\GJ15669-PA 309 GJ15669-PA 22..309 20..311 614 39.3 Plus
Dvir\GJ24547-PA 317 GJ24547-PA 137..285 161..296 149 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18742-PA 311 GK18742-PA 1..311 1..311 1551 91.3 Plus
Dwil\GK24210-PA 323 GK24210-PA 14..323 8..311 859 50.6 Plus
Dwil\GK24211-PA 309 GK24211-PA 22..309 20..311 581 36.6 Plus
Dwil\GK13483-PA 345 GK13483-PA 135..274 158..310 164 28.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12918-PA 311 GE12918-PA 1..311 1..311 1665 98.7 Plus
Dyak\GE18402-PA 323 GE18402-PA 14..323 8..311 866 50.6 Plus
Dyak\GE18403-PA 309 GE18403-PA 11..309 7..311 589 37.3 Plus
Dyak\GE25144-PA 348 GE25144-PA 34..273 24..308 191 25.2 Plus

FI04632.hyp Sequence

Translation from 547 to 1482

> FI04632.hyp
MADKKIGEYYAPPVKMGKWEGFKKFLWNSETSQCLGRTGSSWAKILLFYI
IFYAALTGFFAAIFTVFYQTLDNEKPKWMLDNGLIGSNPGLGFRPMPPEA
NVESTLVWYESSKKDNYKYWVDETSRFLKSYQDLEKQNQVNCSFEHPPQD
DKVCGIDFSSFSPCTADNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTL
PDHMPEELKQHIKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPRM
GFPRYYFPFKNIQGYIPPIVAVQFTVETGVLINIECKAWARNINHDRSDR
RGSVHFELMVD*

FI04632.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
nrv3-PD 311 CG8663-PD 1..311 1..311 1716 100 Plus
nrv3-PC 311 CG8663-PC 1..311 1..311 1716 100 Plus
nrv3-PA 311 CG8663-PA 1..311 1..311 1716 100 Plus
nrv3-PE 313 CG8663-PE 1..313 1..311 1700 99 Plus
nrv2-PG 323 CG9261-PG 14..323 8..311 884 50.3 Plus