Clone FI04643 Report

Search the DGRC for FI04643

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:46
Well:43
Vector:pFlc-1
Associated Gene/TranscriptCG5909-RA
Protein status:FI04643.pep: gold
Sequenced Size:1474

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5909 2008-12-18 5.12 accounting

Clone Sequence Records

FI04643.complete Sequence

1474 bp assembled on 2008-09-15

GenBank Submission: BT044502.1

> FI04643.complete
TCAGATTACAAGTTGATCTGTTGATCTGTTCAGCGCGCACGTTGGAGAAC
TCAATCGTGATCGGGAACGAGATCTCGGAGAGCAGAAGCATCATCATCCG
CATTTGAGACGGGTTTTTAAAAACAGCAGGAAGGCCCCCCACGTTGAGAT
TACGGATTATTGACCATAGCAATCAGTCAGGATGGTGTCTGCGGCGATTC
GACTTGGACTGCTCTTGTGCATCTTGCCCCAGCTGGTCATCAGCCAGAGC
AGCTGCGTCACGCCGGCCCAAGCAGCCGGTCAGTGCATCCGATACCAGGA
GTGCCCCTTCGTGCAGAAGATTCTCGGGATCTACGGTCGGAATATACCAC
GGAAAATCCACAACCAAATTAGTGAGATGCAGTGCAGGAGCACTACGAAT
ACGAGGGACTTCCATCTTTGTTGCCCCAACGAGGCACCTCCTCAATCCAA
TCAGGAGTCGCAGAGGAAGGTCGTGCGATCGGAGGGCGGAAATCTGAACC
GGTATGATCGCCAGGGTCTGCAGCTGCTGAACTCGGTGACCAACTGCGGC
AACAAGGGCAATCCCAAGGTGAGCGGTGGAAAGACGGCCAGGCCAGGCGA
CTTTCCCTGGGTGGCCCTGCTCAAGTACAAGATCAACGATCCGCGTCCAT
TCCGCTGCGGCGGCAGCCTCATCAGCGAACGCCACATCCTGACCGCCGCC
CACTGCATCATCGATCAGCCCGAAGTAATCGCGGTGCGCCTGGGCGAGCA
TGACCTGGAATCGGAGGAGGACTGCCACTATTTGGGCGGTACGAACCGCG
TATGCATTCCGCCCTACGAGGAGTACGGCATAGAGCAGATACGAGTACAT
CCCAACTACGTGCATGGCAAGATCAGCCATGACGTTGCCATCATCAAGCT
GGATCGCGTGGTCAAGGAAAAATCGCATATTAAGCCCGTTTGCCTGCCAA
TCGACCAGAAGTCACAGGAACTGGACTTCGATCAGAGCTTCTTCGTCGCC
GGCTGGGGCGGCACCGAGAAGGAGACTGTGGCCACCAAGCTCCAACAGGC
GCTGATCACCAGGAAGAGCCTGAACGAGTGTCGCCAGTACTACAACAAGG
GTGAGGTGAGCGACAACCACATCTGCGCCACAGGAACTGGGATCAAGCAC
ACTTGCCAGGGAGATTCCGGCGGACCGGTGTTCTTCAAGCATCGCTTCAA
GAACACCTACCGAGTGGTCCAGTACGGTGTGGTCTCCTTCGGCGGACGGC
TATGCGGACAGAACCAGCCAGGAGTCTTCGCCAGTGTCATCGACATGCTG
CCCTGGATCACGCAGAACCTTCAGTAGTGCCAACCGATACTCTCTTTCCT
CAAGACACCAACTTATTTATATTCTTTATATTCTAGTCTTAAGAATTCTT
GCCGCAGGATTATCTAGATTTGTAAATTATTTTAATAAATACTATTAGCA
GCAATATTTAAAAAAAAAAAAAAA

FI04643.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5909-RA 1588 CG5909-RA 134..1588 5..1459 7275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22985195..22985933 727..1459 3450 98.1 Plus
chr3R 27901430 chr3R 22984755..22985075 406..726 1605 100 Plus
chr3R 27901430 chr3R 22984174..22984414 5..245 1175 99.2 Plus
chr3R 27901430 chr3R 22984471..22984632 246..407 795 99.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG5909-RA 1146 CG5909-PA 1..1146 182..1327 5730 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:32 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG5909-RA 1455 CG5909-RA 1..1455 5..1459 7275 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG5909-PA 381 CG5909-PA 1..381 182..1324 2052 100 Plus
grass-PB 377 CG5896-PB 32..372 254..1321 510 33 Plus
grass-PA 335 CG5896-PA 20..330 335..1321 483 33.5 Plus
Sp7-PF 391 CG3066-PF 12..390 209..1324 433 30.8 Plus
Sp7-PE 391 CG3066-PE 12..390 209..1324 433 30.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27162179..27162915 727..1463 3685 100 Plus
3R 32079331 3R 27161739..27162059 406..726 1605 100 Plus
3R 32079331 3R 27161158..27161398 5..245 1205 100 Plus
3R 32079331 3R 27161455..27161616 246..407 810 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26903010..26903746 727..1463 3685 100 Plus
3R 31820162 3R 26902570..26902890 406..726 1605 100 Plus
3R 31820162 3R 26901989..26902229 5..245 1205 100 Plus
3R 31820162 3R 26902286..26902447 246..407 810 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:17:33 has no hits.

FI04643.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:32:27 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22985195..22985933 727..1459 98   Plus
chr3R 22984756..22985075 407..726 100 -> Plus
chr3R 22984471..22984631 246..406 99 -> Plus
chr3R 22984172..22984414 1..245 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:48:54 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 1..1146 182..1327 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:01:45 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 1..1146 182..1327 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:25:26 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 1..1146 182..1327 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:32:27 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 1..1146 182..1327 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:20:15 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 1..1455 5..1459 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:01:45 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 1..1455 5..1459 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:25:26 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 1..1455 5..1459 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-15 12:14:09 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 5..1461 1..1459 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:32:27 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
CG5909-RA 1..1455 5..1459 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:32:27 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27162179..27162911 727..1459 100   Plus
3R 27161740..27162059 407..726 100 -> Plus
3R 27161455..27161615 246..406 100 -> Plus
3R 27161156..27161398 1..245 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:25:26 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22987901..22988633 727..1459 100   Plus
arm_3R 22987462..22987781 407..726 100 -> Plus
arm_3R 22987177..22987337 246..406 100 -> Plus
arm_3R 22986878..22987120 1..245 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:29:17 Download gff for FI04643.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26903010..26903742 727..1459 100   Plus
3R 26902571..26902890 407..726 100 -> Plus
3R 26902286..26902446 246..406 100 -> Plus
3R 26901987..26902229 1..245 99 -> Plus

FI04643.pep Sequence

Translation from 181 to 1326

> FI04643.pep
MVSAAIRLGLLLCILPQLVISQSSCVTPAQAAGQCIRYQECPFVQKILGI
YGRNIPRKIHNQISEMQCRSTTNTRDFHLCCPNEAPPQSNQESQRKVVRS
EGGNLNRYDRQGLQLLNSVTNCGNKGNPKVSGGKTARPGDFPWVALLKYK
INDPRPFRCGGSLISERHILTAAHCIIDQPEVIAVRLGEHDLESEEDCHY
LGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKSHI
KPVCLPIDQKSQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNEC
RQYYNKGEVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGV
VSFGGRLCGQNQPGVFASVIDMLPWITQNLQ*

FI04643.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 22:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23282-PA 376 GF23282-PA 3..376 1..381 1236 59.1 Plus
Dana\GF23281-PA 372 GF23281-PA 27..367 25..380 487 32.1 Plus
Dana\GF15010-PA 628 GF15010-PA 351..623 109..380 478 37.9 Plus
Dana\GF17682-PA 394 GF17682-PA 18..393 10..381 414 31 Plus
Dana\GF12631-PA 271 GF12631-PA 3..268 111..380 408 35 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 22:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11533-PA 385 GG11533-PA 1..385 1..381 1860 92.7 Plus
Dere\GG20545-PA 371 GG20545-PA 37..370 25..381 510 32.1 Plus
Dere\GG11531-PA 377 GG11531-PA 32..372 25..380 488 32.7 Plus
Dere\GG16913-PA 392 GG16913-PA 37..391 25..381 410 29.2 Plus
Dere\GG12275-PA 392 GG12275-PA 10..391 8..381 403 30.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 22:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19618-PA 388 GH19618-PA 19..387 19..380 1042 52.8 Plus
Dgri\GH19627-PA 370 GH19627-PA 5..369 23..380 1025 52.6 Plus
Dgri\GH20624-PA 374 GH20624-PA 28..368 25..380 517 33.8 Plus
Dgri\GH17524-PA 374 GH17524-PA 28..368 25..380 517 33.8 Plus
Dgri\GH20292-PA 242 GH20292-PA 4..239 142..380 467 37.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 22:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG5909-PA 381 CG5909-PA 1..381 1..381 2052 100 Plus
grass-PB 377 CG5896-PB 32..372 25..380 510 33 Plus
grass-PA 335 CG5896-PA 20..330 52..380 483 33.5 Plus
Sp7-PF 391 CG3066-PF 12..390 10..381 433 30.8 Plus
Sp7-PE 391 CG3066-PE 12..390 10..381 433 30.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 22:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22268-PA 380 GI22268-PA 1..379 15..380 1082 53.5 Plus
Dmoj\GI23202-PA 376 GI23202-PA 31..368 25..377 507 33.1 Plus
Dmoj\GI24877-PA 392 GI24877-PA 37..391 25..381 417 30.5 Plus
Dmoj\GI22780-PA 412 GI22780-PA 2..411 4..381 410 30.2 Plus
Dmoj\GI24127-PA 389 GI24127-PA 8..388 10..381 394 29.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 22:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23906-PA 390 GL23906-PA 4..389 1..380 1279 60.9 Plus
Dper\GL11854-PA 352 GL11854-PA 17..349 25..380 529 34 Plus
Dper\GL23905-PA 374 GL23905-PA 29..369 25..380 514 33.2 Plus
Dper\GL11766-PA 376 GL11766-PA 31..374 25..380 436 31.1 Plus
Dper\GL17488-PA 282 GL17488-PA 29..273 121..376 423 37.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 22:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27102-PA 390 GA27102-PA 8..389 3..380 1279 61.3 Plus
Dpse\GA25144-PB 366 GA25144-PB 9..363 10..380 531 33.1 Plus
Dpse\GA19211-PA 374 GA19211-PA 29..369 25..380 507 32.6 Plus
Dpse\GA19211-PB 335 GA19211-PB 20..330 52..380 476 33.1 Plus
Dpse\GA24065-PA 376 GA24065-PA 7..374 8..380 453 30.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 22:12:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10374-PA 385 GM10374-PA 1..385 1..381 1974 96.4 Plus
Dsec\GM10373-PA 377 GM10373-PA 32..372 25..380 501 32.4 Plus
Dsec\GM21637-PA 306 GM21637-PA 34..305 112..381 490 35.4 Plus
Dsec\GM10972-PA 391 GM10972-PA 12..390 10..381 410 30.9 Plus
Dsec\GM24220-PA 402 GM24220-PA 47..401 25..381 404 29.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 22:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15187-PA 367 GD15187-PA 1..367 1..381 1840 91.7 Plus
Dsim\GD15186-PA 419 GD15186-PA 82..414 33..380 479 32.3 Plus
Dsim\GD19715-PA 392 GD19715-PA 29..391 25..381 423 30.6 Plus
Dsim\GD19946-PA 391 GD19946-PA 12..390 10..381 411 31.1 Plus
Dsim\GD19011-PA 392 GD19011-PA 37..391 25..381 404 29.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 22:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24059-PA 397 GJ24059-PA 8..395 8..379 1052 51.8 Plus
Dvir\GJ22863-PA 372 GJ22863-PA 27..367 25..380 512 32.6 Plus
Dvir\GJ21978-PA 296 GJ21978-PA 16..289 93..377 500 36.7 Plus
Dvir\GJ21212-PA 268 GJ21212-PA 14..265 126..380 479 37.1 Plus
Dvir\GJ21214-PA 280 GJ21214-PA 9..277 109..380 437 34.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 22:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11885-PA 388 GK11885-PA 1..387 1..380 1060 49.9 Plus
Dwil\GK11884-PA 375 GK11884-PA 10..370 5..380 499 32.2 Plus
Dwil\GK13136-PA 412 GK13136-PA 3..411 6..381 475 31.2 Plus
Dwil\GK12018-PA 384 GK12018-PA 1..383 1..381 419 29.5 Plus
Dwil\GK10951-PA 391 GK10951-PA 26..390 25..381 409 30.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 22:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23722-PA 386 GE23722-PA 1..386 1..381 1848 91.7 Plus
Dyak\GE11731-PA 371 GE11731-PA 37..370 25..381 514 32.1 Plus
Dyak\GE23721-PA 377 GE23721-PA 32..372 25..380 498 32.7 Plus
Dyak\GE24296-PA 392 GE24296-PA 37..391 25..381 408 30 Plus
Dyak\GE10383-PA 404 GE10383-PA 30..403 20..381 405 29.4 Plus

FI04643.hyp Sequence

Translation from 181 to 1326

> FI04643.hyp
MVSAAIRLGLLLCILPQLVISQSSCVTPAQAAGQCIRYQECPFVQKILGI
YGRNIPRKIHNQISEMQCRSTTNTRDFHLCCPNEAPPQSNQESQRKVVRS
EGGNLNRYDRQGLQLLNSVTNCGNKGNPKVSGGKTARPGDFPWVALLKYK
INDPRPFRCGGSLISERHILTAAHCIIDQPEVIAVRLGEHDLESEEDCHY
LGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKSHI
KPVCLPIDQKSQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNEC
RQYYNKGEVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGV
VSFGGRLCGQNQPGVFASVIDMLPWITQNLQ*

FI04643.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG5909-PA 381 CG5909-PA 1..381 1..381 2052 100 Plus
grass-PB 377 CG5896-PB 32..372 25..380 510 33 Plus
grass-PA 335 CG5896-PA 20..330 52..380 483 33.5 Plus
Sp7-PF 391 CG3066-PF 12..390 10..381 433 30.8 Plus
Sp7-PE 391 CG3066-PE 12..390 10..381 433 30.8 Plus