Clone FI04660 Report

Search the DGRC for FI04660

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:46
Well:60
Vector:pFlc-1
Associated Gene/TranscriptRat1-RA
Protein status:FI04660.pep: gold
Sequenced Size:3361

Clone Sequence Records

FI04660.complete Sequence

3361 bp assembled on 2009-01-05

GenBank Submission: BT056259.1

> FI04660.complete
GGTGGTATAGGTGAAGAAAACGAGGAAAGCAGAGTTTGACCAAATATAAG
AAAAATAGAGCCTAAACCGAAGATATAATGGGAGTTCCAGCATTCTTTCG
CTGGCTGAGCCGGAAGTATCCATCCGTGATAATAGAATGCAATGAAAACA
AGCAGGTGGACGCGGACACCGGTCGAAACATCTACGAGGACCCCACCTTG
CCGAATCCAAATGGGATAGAGTTTGACAATCTGTACCTGGACATGAACGG
CATCATCCATCCGTGCACGCATCCGGAGGACAAGCCGGCGCCGAAGAACG
AGGACGAGATGATGGTGGCCATCTTCGAATGCATCGACCGTCTGTTCGGT
ATTGTACGTCCTCGAAAACTGCTCTATATGGCCATCGATGGCGTTGCTCC
ACGAGCCAAGATGAATCAGCAGCGATCTCGTCGCTTCCGAGCGGCCAAGG
AAACCACCGAAAAGCGGCTGGAGATAGCACGGATCCGCGAGGAGCTGCTG
AGCCGCGGCTGCAAGCTGCCACCGGAGAAGGAGAAGGGTGAACACTTTGA
CTCCAACTGCATCACGCCGGGCACCCCGTTCATGGACCGACTGAGCAAGT
GTTTGCACTACTTTGTTCATGATCGTCAAAACAATAACCCGGCCTGGAAG
GGCATCAAGGTGATCCTGTCGGACGCCAATGTGCCCGGTGAGGGTGAGCA
CAAGATCATGGATTACATTCGCAAGCAGCGTGCCCAGCCTGATCACGATC
CCAACACGCAGCACGTCTTGTGCGGAGCCGACGCCGATCTCATCATGTTG
GGTCTGGCCACGCACGAGCCCAACTTCACAATCATTCGGGAGGAGTTCCT
GCCGAATAAGCCGCGTCCCTGCGACATCTGCAACGGATTTGGCCACGAGA
TGGACAAGTGTGTCGGACTCGGAGCGACTGCGCCAACTAGCGCCAATTTT
AAGCCCGATGTGCCCATAGGCGCCGAGGTAAAGTTCATCTTTGTGCGGCT
GAGTGTGCTACGCGAGTACCTAAAGCAGACTCTTGAGATGCCGAATCTGC
CATTTGAGTACAGTTTCGAGCGCGCGTTGGACGACTGGGTGTTCATGTGC
TTCTTTGTGGGCAATGATTTTCTGCCCCACCTGCCTAGCCTGGAGATTCG
CGAGGGTGCAGTAGATCGATTGGTGGAGTTATACAAGAAGTGCGTTTACA
AGACAAGGGGCTATCTCACCGACTCGGGAGATGTAAATCTTGACCGGGTG
CAGCTGATTATGACCGACTTGGGCAATGCCGAGGACCAGATCTTCAAGAG
CCGACAGCGACGCGAGGAGCAGTTCAAGGCCAGGGACAAGGCGCGCAAGA
GGCAGGAAAGGAATCAGGACCACGGATCCTTGAATCAGTCTGCTTTTGGC
GCCAGCGCCGTGGGTCCAAACAGCCAGCAAAGGAGCGTCGGCAACTACAA
GGAGGAGGCCGCGGCACTTCGTAATAGAAAACGGACGAGTGACATGGCCA
ATTTGGATGACGAAGATGAGGAGGAGAATAACGACGAGGTGCGATTGTGG
GAGGATGGCTTCAAGGACCGCTACTACGAATCCAAGTTTGACGTGGCACC
GGGTAACCAGCAGTTCCGATACGCTGTAGCCCTGCAGTATGTCCGAGGAT
TGTGCTGGGTTCTTAAGTACTACTATCAGGGCTGTGCCTCCTGGAACTGG
TACTTCCCATACCATTATGCACCCTTCGCATCGGATTTTGTCAACATCCA
GGGACTGTCCACGATGTTCGAAAAGGGCACAAAGCCGTTTAATCCGCTCG
AGCAACTGATGGGCGTCTTTCCGGCAGCCAGTAGTTCACACGTGCCCGAG
CCGTGGGCCAAGCTCATGTCCGATCCGGAGTCACCGATCATTGACTTCTA
TCCGGAGGACTTTAAGATCGATCTGAATGGCAAGAAGTTCGCCTGGCAGG
GAGTGGCTCTGCTGCCGTTCGTCGATGAGAAGCGTCTCTTCAAGGCTTTG
GTTCCCTACTATGATCAACTTACTGGAGAGGAGGTGAAGCGAAACAAGCG
TGGAGACAATTACCTGTACATCAGCAATCAGAGTCCGCACTACAAAAAGG
TGAAGAAAATCAGCGAAAAGGATGATGAGAGCGTTTGCAAAGCCATCTCA
TTTGACGGTATGCGCGGCACTTTGGGAAAAACCGAACTAAACACTGCCAT
CAGCGGCGTTCTTAAGTCGCCGATTTCCGGGCTATCGGACATTAATGACA
ATATAACCGTGACGACCACGTTCAGGGATCCGGAATACGATGAAGACTAC
ATTTTCGAAGCGAAGCGCCTCGAAAACGCCGTAGATCCGCCACAGGTGCT
GCCAAATGAGCAGTCTGGTAACAAGCATCGTCCCGTCATCGGTTTTAATA
GCCACTTGACCAGGGCCTACGTTCCGGATAGTGGTCACCGCATGCTGAAC
GCTGGCATAAGGAACCAACAGGGTGGCGGTGGCAATGGAGGTGGAGGAGG
AGGCTACGGGCAAGGAGGCGGCTACGGCCAGGGAATAGGCGGAAACCAAG
GACAGAGCTATCAGAACAATAGCCGAAACTATAACTACAACTACAACAAT
AACTACAATCAGCACCAGGGTGGCGGCTATCAAAACAACTACAATAACCG
ACAGCAGCAGCAATATGGCCACAATCAGAGATTCAACCAGGACAATTCGA
ATCAGCAGCAGCGCAACTTTAACAACTATAATGGTCCAAGGAACAACAAC
TACCAGCAACAAGGCGGCAGCAGGCAACAGAATCAGAATTATAGACGGTT
TTAGGTGTATCATACAAACAATATAATATGTAGCGCATAACAAAAGTGTA
ATCCATATTAATTTACATTATTTTTTAATGAAGAAAATATACTGATTAAG
GATTTCCAAACAAACTCATGCCAAGTTCTGAGTTTGTTCTTTAAATGAAA
TACCCATTGCATTTCTATCAAAGCAGCTTACAGCCAACATCTAGTCTTAG
TGCCTCAAAGAAAATAAGTCAAATTACAATAATGATCATTTCTCTTTCCA
TTGATTGCGTAAAAAAAGCAAACTAGCTGGATAATACAAAAAAATGAGAC
GATTGTTATTTTCAGATAAGGAAAATGGAACATAATTTGACAGGAAATTG
GATAATATCAAAACAATTTCTAGTGGAGTAAACAATTGAATTTAAGAAAA
ACTTCGCAAACATTTTGTTTTAAATCCGGAGTCATAATAAATCCAGTAGT
TTTTATGGAATAGCATTCGCTATATTTAACGAATGGAATGTTATTATTTC
GATTTCCATGTAACATAATAAATATTTTAATTTCGAAAAAAAAAAGAAAA
AAAAAAAAAAA

FI04660.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
Rat1-RA 3346 Rat1-RA 4..3341 2..3339 16690 100 Plus
wee.a 2365 wee.a 2200..2365 3339..3174 830 100 Minus
wee-RA 2479 wee-RA 2314..2479 3339..3174 830 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6907188..6910525 2..3339 16540 99.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
Rat1-RB 2727 CG10354-PB 1..2727 78..2804 13635 100 Plus
Rat1-RA 2727 CG10354-PA 1..2727 78..2804 13635 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:34 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
Rat1-RA 3341 CG10354-RA 8..3341 2..3335 16670 100 Plus
Rat1-RB 2975 CG10354-RB 8..2975 2..2969 14840 100 Plus
Wee1-RB 2652 CG4488-RB 2315..2652 3339..3002 1690 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Rat1-PB 908 CG10354-PB 1..792 78..2453 4182 100 Plus
Rat1-PA 908 CG10354-PA 1..792 78..2453 4182 100 Plus
pcm-PA 1612 CG3291-PA 1..581 78..2069 1088 37.8 Plus
pcm-PB 1613 CG3291-PB 1..581 78..2069 1088 37.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6908090..6911427 2..3339 16690 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6908090..6911427 2..3339 16690 100 Plus
X 23527363 X 19499707..19499771 283..219 175 84.6 Minus
X 23527363 X 19499299..19499337 721..683 150 92.3 Minus
Blast to na_te.dros performed 2014-11-27 02:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
McClintock 6450 McClintock McCLINTOCK 6450bp 863..1267 2809..3201 125 51.5 Plus

FI04660.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:20:26 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6907187..6910521 1..3335 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:10 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
CG10354-RA 1..2727 78..2804 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:22:22 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
Rat1-RA 1..2727 78..2804 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:04 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
Rat1-RA 1..2727 78..2804 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:20:26 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
Rat1-RA 1..2727 78..2804 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-05 17:41:44 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
CG10354-RA 3..3337 1..3335 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:22:22 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
Rat1-RA 3..3337 1..3335 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:04 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
Rat1-RA 7..3341 1..3335 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:20:26 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
Rat1-RA 7..3341 1..3335 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:20:26 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6908089..6911423 1..3335 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:04 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6908089..6911423 1..3335 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:10:15 Download gff for FI04660.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6908089..6911423 1..3335 99   Plus

FI04660.pep Sequence

Translation from 77 to 2803

> FI04660.pep
MGVPAFFRWLSRKYPSVIIECNENKQVDADTGRNIYEDPTLPNPNGIEFD
NLYLDMNGIIHPCTHPEDKPAPKNEDEMMVAIFECIDRLFGIVRPRKLLY
MAIDGVAPRAKMNQQRSRRFRAAKETTEKRLEIARIREELLSRGCKLPPE
KEKGEHFDSNCITPGTPFMDRLSKCLHYFVHDRQNNNPAWKGIKVILSDA
NVPGEGEHKIMDYIRKQRAQPDHDPNTQHVLCGADADLIMLGLATHEPNF
TIIREEFLPNKPRPCDICNGFGHEMDKCVGLGATAPTSANFKPDVPIGAE
VKFIFVRLSVLREYLKQTLEMPNLPFEYSFERALDDWVFMCFFVGNDFLP
HLPSLEIREGAVDRLVELYKKCVYKTRGYLTDSGDVNLDRVQLIMTDLGN
AEDQIFKSRQRREEQFKARDKARKRQERNQDHGSLNQSAFGASAVGPNSQ
QRSVGNYKEEAAALRNRKRTSDMANLDDEDEEENNDEVRLWEDGFKDRYY
ESKFDVAPGNQQFRYAVALQYVRGLCWVLKYYYQGCASWNWYFPYHYAPF
ASDFVNIQGLSTMFEKGTKPFNPLEQLMGVFPAASSSHVPEPWAKLMSDP
ESPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEKRLFKALVPYYDQLTG
EEVKRNKRGDNYLYISNQSPHYKKVKKISEKDDESVCKAISFDGMRGTLG
KTELNTAISGVLKSPISGLSDINDNITVTTTFRDPEYDEDYIFEAKRLEN
AVDPPQVLPNEQSGNKHRPVIGFNSHLTRAYVPDSGHRMLNAGIRNQQGG
GGNGGGGGGYGQGGGYGQGIGGNQGQSYQNNSRNYNYNYNNNYNQHQGGG
YQNNYNNRQQQQYGHNQRFNQDNSNQQQRNFNNYNGPRNNNYQQQGGSRQ
QNQNYRRF*

FI04660.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15434-PA 911 GF15434-PA 1..881 1..879 3825 85.7 Plus
Dana\GF20490-PA 1605 GF20490-PA 1..581 1..664 1094 38.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10442-PA 902 GG10442-PA 1..902 1..908 4251 96.5 Plus
Dere\GG18055-PA 1583 GG18055-PA 1..581 1..664 1138 37.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17871-PA 1754 GH17871-PA 1..578 1..664 1079 37.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
Rat1-PB 908 CG10354-PB 1..908 1..908 4922 100 Plus
Rat1-PA 908 CG10354-PA 1..908 1..908 4922 100 Plus
pcm-PA 1612 CG3291-PA 1..581 1..664 1116 38.8 Plus
pcm-PB 1613 CG3291-PB 1..581 1..664 1116 38.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23821-PA 793 GI23821-PA 1..774 1..782 3403 79.8 Plus
Dmoj\GI16439-PA 1816 GI16439-PA 1..584 1..664 1120 38.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14782-PA 1039 GL14782-PA 112..415 339..664 488 36.8 Plus
Dper\GL14782-PA 1039 GL14782-PA 1..105 1..123 283 45.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10268-PA 916 GA10268-PA 1..793 1..799 3710 86 Plus
Dpse\GA17195-PA 1533 GA17195-PA 1..583 1..664 1120 38.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16241-PA 464 GM16241-PA 1..460 1..461 2386 95.9 Plus
Dsec\GM16250-PA 431 GM16250-PA 1..323 473..795 1671 98.5 Plus
Dsec\GM22742-PA 1585 GM22742-PA 1..580 1..664 1135 38.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23438-PA 842 GD23438-PA 1..842 56..908 3987 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23613-PA 774 GJ23613-PA 1..771 1..772 3281 79 Plus
Dvir\GJ15840-PA 1656 GJ15840-PA 1..583 1..664 1135 37.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24252-PA 924 GK24252-PA 1..807 1..795 3504 81.7 Plus
Dwil\GK17975-PA 1638 GK17975-PA 1..606 1..669 1131 37.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14198-PA 897 GE14198-PA 1..864 1..874 4177 94.6 Plus
Dyak\GE17387-PA 1581 GE17387-PA 1..581 1..664 1145 38.7 Plus

FI04660.hyp Sequence

Translation from 77 to 2803

> FI04660.hyp
MGVPAFFRWLSRKYPSVIIECNENKQVDADTGRNIYEDPTLPNPNGIEFD
NLYLDMNGIIHPCTHPEDKPAPKNEDEMMVAIFECIDRLFGIVRPRKLLY
MAIDGVAPRAKMNQQRSRRFRAAKETTEKRLEIARIREELLSRGCKLPPE
KEKGEHFDSNCITPGTPFMDRLSKCLHYFVHDRQNNNPAWKGIKVILSDA
NVPGEGEHKIMDYIRKQRAQPDHDPNTQHVLCGADADLIMLGLATHEPNF
TIIREEFLPNKPRPCDICNGFGHEMDKCVGLGATAPTSANFKPDVPIGAE
VKFIFVRLSVLREYLKQTLEMPNLPFEYSFERALDDWVFMCFFVGNDFLP
HLPSLEIREGAVDRLVELYKKCVYKTRGYLTDSGDVNLDRVQLIMTDLGN
AEDQIFKSRQRREEQFKARDKARKRQERNQDHGSLNQSAFGASAVGPNSQ
QRSVGNYKEEAAALRNRKRTSDMANLDDEDEEENNDEVRLWEDGFKDRYY
ESKFDVAPGNQQFRYAVALQYVRGLCWVLKYYYQGCASWNWYFPYHYAPF
ASDFVNIQGLSTMFEKGTKPFNPLEQLMGVFPAASSSHVPEPWAKLMSDP
ESPIIDFYPEDFKIDLNGKKFAWQGVALLPFVDEKRLFKALVPYYDQLTG
EEVKRNKRGDNYLYISNQSPHYKKVKKISEKDDESVCKAISFDGMRGTLG
KTELNTAISGVLKSPISGLSDINDNITVTTTFRDPEYDEDYIFEAKRLEN
AVDPPQVLPNEQSGNKHRPVIGFNSHLTRAYVPDSGHRMLNAGIRNQQGG
GGNGGGGGGYGQGGGYGQGIGGNQGQSYQNNSRNYNYNYNNNYNQHQGGG
YQNNYNNRQQQQYGHNQRFNQDNSNQQQRNFNNYNGPRNNNYQQQGGSRQ
QNQNYRRF*

FI04660.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
Rat1-PB 908 CG10354-PB 1..908 1..908 4922 100 Plus
Rat1-PA 908 CG10354-PA 1..908 1..908 4922 100 Plus
pcm-PA 1612 CG3291-PA 1..581 1..664 1116 38.8 Plus
pcm-PB 1613 CG3291-PB 1..581 1..664 1116 38.8 Plus