Clone FI04664 Report

Search the DGRC for FI04664

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:46
Well:64
Vector:pFlc-1
Associated Gene/TranscriptIrk2-RB
Protein status:FI04664.pep: gold
Sequenced Size:1609

Clone Sequence Records

FI04664.complete Sequence

1609 bp assembled on 2009-05-13

GenBank Submission: BT083434.1

> FI04664.complete
GGCTTCAGTTTCGTTCAGAACCGCGAAGTTAAAACGTCTAGAGAAATGCA
GGTCCCGCTCAGCGATGTTCAGGTCCTGCAGGATCCCACCGACGCGGAAA
CCCTTGTCGGCGGCGACAAGGAGGAGACCTTTGCCCACATGAAGGAGTGG
AAGCGCCAGTACATGCGGGGCATCTCGCACACGCCATCGCAGGCGGGAGT
CTACTACGAGGCCTTGAAGGGTTCCAGCCACTCGCTGGCCAAAGGATCTC
GCAATTTCCGGCCTGGCAGCATGAGACGTGTTCGCCGACGAGCGGTCTTC
AAAAATGGTGACTGCAATGTGGTGCAGAAGCACCTGCAAAGACGCCGAGT
TCGTTTCCTGCAGGACATGTACACCACCATGGTGGATTGGCAGTGGCGGT
GGACTCTCTTGGCCTTCGCACTCAGCTTTATCCTGTCTTGGCTCTTCTTT
GCTCTCATCTGGTGGCTGATTATCTACACACACGGAGACTTGGAAGAGCC
TCACTTGCCAGAAAACCAAGAGGAATCTGGTTGGGCGCCTTGTGTTTCGG
CCATCGATGGCTTTACTTCCTGCTTCCTGTTCTCCATTGAAACGCAGCAC
ACTATTGGCTACGGTGTCCGAACCACCTCGCCCGAGTGTCCAGAGGCCAT
CTTCATGATGTGCTTCCAGTCCATCTATGGCGTGATGTCTTCAGCATTTA
TGGCCGGAATAGTGTTTGCCAAGATGACAAGGGCCAAACAGCGGGCACAG
ACTTTGTTGTTCTCCAAACACGCCGTAATTTGCCAACGTGATGGCACCCT
TTCGCTGATGTTCCGTGTGGGTGACATGCGAAAATCACACATCATTGGAG
CCGGAGTGAGGGCTCAGTTGATCAGGACAAAGAGCACCAAGGAGGGTGAG
GTGATGACACAGTACTTCACAGAACTGGAGATCGGTACTGATGACTCCGG
CTCTGATTTGTTCTTCATCTGGCCCATGGTCATCGAGCACAAGATCGACG
AGAACTCACCGCTCTATAATCTTAATGCCACTGATATGCTGCAGGATAAG
TTCGAAATCGTGGTGATCCTAGAGGGCACCGTGGAGTCCACTGGACAGAG
CACTCAAGCCAGATCCAGCTATATTAACACTGAGATCCTTTGGGGACATC
GTTTCGATCCAGTGGTGTTGTACAACAAGGATCTGCAGGCCTATGAAATC
GACTACGCTCGCTTTAACGAAACCACTCAGGTGGACACTCCGTTGTGCAG
TGCTCGGGAATTGAACGAGATCTACAAGATCCAGGAGGGATTCCGCACAC
CAGAAACCACCTTTACCATGCGTCAACTGTCCCACAATCATTCTGACCAG
GCCTCCTAGGCGCAGATTCCAGTGTTTCGTCCCTTGTGTTGCTATAGTTG
TAATCGTGTTTGTCCTATCTTCCCCATCGACCCAATCGAGGTGCTCCTGC
AGTTCCGGCTATCAGACACCTGGAAGGCAAAGCCGCCTGCGTTGGCAGCT
CTCGGTGCCCTTGTAATGGACCTCGACTATCAACGCACTTAAATGTACGA
GTTACCCTACGAAAATAAGTTAATAAACGCTTTAGTCAGAGACAAAAAAA
AAAAAAAAA

FI04664.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Irk2.e 1946 Irk2.e 1..1592 2..1593 7945 99.9 Plus
Irk2-RB 1725 Irk2-RB 12..1603 2..1593 7945 99.9 Plus
Irk2.b 1601 Irk2.b 1..1302 2..1303 6510 100 Plus
Irk2.b 1601 Irk2.b 1309..1598 1304..1593 1435 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19337753..19338537 1303..519 3835 99.2 Minus
chr3R 27901430 chr3R 19338589..19338864 520..245 1350 99.3 Minus
chr3R 27901430 chr3R 19341459..19341702 245..2 1160 98.4 Minus
chr3R 27901430 chr3R 19337346..19337520 1593..1419 845 98.9 Minus
chr3R 27901430 chr3R 19337584..19337702 1418..1301 545 99.2 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Irk2-RB 1314 CG4370-PB 1..1314 46..1359 6570 100 Plus
Irk2-RC 1356 CG4370-PC 1..1258 46..1303 6290 100 Plus
Irk2-RA 1362 CG4370-PA 248..1362 245..1359 5575 100 Plus
Irk2-RC 1356 CG4370-PC 1259..1356 1419..1516 490 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:35 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Irk2-RB 1600 CG4370-RB 6..1597 2..1593 7945 99.9 Plus
Irk2-RA 1894 CG4370-RA 543..1891 245..1593 6730 99.9 Plus
Irk2-RD 2248 CG4370-RD 543..1894 245..1593 6665 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Irk2-PB 437 CG4370-PB 1..437 46..1356 2308 100 Plus
Irk2-PC 451 CG4370-PC 1..429 46..1332 2219 98.1 Plus
Irk2-PA 453 CG4370-PA 84..453 247..1356 1957 100 Plus
Irk2-PD 454 CG4370-PD 84..454 247..1356 1945 99.7 Plus
Irk1-PB 555 CG44159-PB 14..377 199..1272 1069 57.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23514377..23515161 1303..519 3925 100 Minus
3R 32079331 3R 23515213..23515488 520..245 1380 100 Minus
3R 32079331 3R 23518070..23518313 245..2 1220 100 Minus
3R 32079331 3R 23513971..23514145 1593..1419 860 99.4 Minus
3R 32079331 3R 23514209..23514326 1418..1301 590 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23255208..23255992 1303..519 3925 100 Minus
3R 31820162 3R 23256044..23256319 520..245 1380 100 Minus
3R 31820162 3R 23258901..23259144 245..2 1220 100 Minus
3R 31820162 3R 23254802..23254976 1593..1419 860 99.4 Minus
3R 31820162 3R 23255040..23255157 1418..1301 590 100 Minus
Blast to na_te.dros performed on 2014-11-27 02:00:29 has no hits.

FI04664.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:09:49 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19341459..19341702 1..245 97   Minus
chr3R 19338589..19338863 246..520 99 <- Minus
chr3R 19337753..19338535 521..1303 99 <- Minus
chr3R 19337584..19337699 1304..1418 99 <- Minus
chr3R 19337346..19337520 1419..1593 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:53:45 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
Irk2-RB 1..1314 46..1359 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:52:06 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
Irk2-RB 1..1314 46..1359 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:37:28 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
Irk2-RB 1..1314 46..1359 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:09:49 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
Irk2-RB 1..1314 46..1359 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 17:40:24 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
Irk2-RB 1..1592 2..1593 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:52:05 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
Irk2-RB 1..1592 2..1593 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:37:28 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
Irk2-RB 4..1597 1..1593 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:09:49 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
Irk2-RB 4..1597 1..1593 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:09:49 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23518070..23518313 1..245 99   Minus
3R 23515213..23515487 246..520 100 <- Minus
3R 23514377..23515159 521..1303 100 <- Minus
3R 23514209..23514323 1304..1418 100 <- Minus
3R 23513971..23514145 1419..1593 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:37:28 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19343792..19344035 1..245 99   Minus
arm_3R 19340935..19341209 246..520 100 <- Minus
arm_3R 19340099..19340881 521..1303 100 <- Minus
arm_3R 19339931..19340045 1304..1418 100 <- Minus
arm_3R 19339693..19339867 1419..1593 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:42:53 Download gff for FI04664.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23258901..23259144 1..245 99   Minus
3R 23256044..23256318 246..520 100 <- Minus
3R 23255208..23255990 521..1303 100 <- Minus
3R 23255040..23255154 1304..1418 100 <- Minus
3R 23254802..23254976 1419..1593 99 <- Minus

FI04664.pep Sequence

Translation from 0 to 1358

> FI04664.pep
GFSFVQNREVKTSREMQVPLSDVQVLQDPTDAETLVGGDKEETFAHMKEW
KRQYMRGISHTPSQAGVYYEALKGSSHSLAKGSRNFRPGSMRRVRRRAVF
KNGDCNVVQKHLQRRRVRFLQDMYTTMVDWQWRWTLLAFALSFILSWLFF
ALIWWLIIYTHGDLEEPHLPENQEESGWAPCVSAIDGFTSCFLFSIETQH
TIGYGVRTTSPECPEAIFMMCFQSIYGVMSSAFMAGIVFAKMTRAKQRAQ
TLLFSKHAVICQRDGTLSLMFRVGDMRKSHIIGAGVRAQLIRTKSTKEGE
VMTQYFTELEIGTDDSGSDLFFIWPMVIEHKIDENSPLYNLNATDMLQDK
FEIVVILEGTVESTGQSTQARSSYINTEILWGHRFDPVVLYNKDLQAYEI
DYARFNETTQVDTPLCSARELNEIYKIQEGFRTPETTFTMRQLSHNHSDQ
AS*

FI04664.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18763-PA 453 GF18763-PA 84..453 83..452 1996 98.4 Plus
Dana\GF16984-PA 570 GF16984-PA 53..391 90..424 1114 60.2 Plus
Dana\GF14817-PA 438 GF14817-PA 105..437 91..426 605 34.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12432-PA 437 GG12432-PA 1..437 16..452 2368 99.3 Plus
Dere\GG11193-PA 551 GG11193-PA 39..377 90..424 1107 60.2 Plus
Dere\GG21688-PA 442 GG21688-PA 95..428 79..415 588 33.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20768-PA 535 GH20768-PA 99..535 15..452 2238 93.8 Plus
Dgri\GH19549-PA 561 GH19549-PA 39..377 90..424 1113 60.8 Plus
Dgri\GH10563-PA 441 GH10563-PA 101..422 91..415 600 36.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
Irk2-PB 437 CG4370-PB 1..437 16..452 2308 100 Plus
Irk2-PC 451 CG4370-PC 1..429 16..444 2219 98.1 Plus
Irk2-PA 453 CG4370-PA 84..453 83..452 1957 100 Plus
Irk2-PD 454 CG4370-PD 84..454 83..452 1945 99.7 Plus
Irk1-PB 555 CG44159-PB 14..377 67..424 1069 57.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:27:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10708-PA 532 GI10708-PA 90..532 10..452 2275 93.9 Plus
Dmoj\GI22262-PA 556 GI22262-PA 1..377 47..424 1112 55.5 Plus
Dmoj\GI16851-PA 512 GI16851-PA 87..407 92..415 601 36.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13847-PA 453 GL13847-PA 84..453 83..452 1973 97.6 Plus
Dper\GL24490-PA 549 GL24490-PA 14..377 67..424 1111 57.1 Plus
Dper\GL14708-PA 514 GL14708-PA 211..498 125..415 527 35.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18138-PB 440 GA18138-PB 1..440 16..452 2308 96.4 Plus
Dpse\GA18138-PC 454 GA18138-PC 1..424 16..436 2211 95.8 Plus
Dpse\GA18138-PA 453 GA18138-PA 84..453 83..452 1973 97.6 Plus
Dpse\GA19830-PA 547 GA19830-PA 14..377 67..424 1111 57.1 Plus
Dpse\GA19830-PB 523 GA19830-PB 15..353 90..424 1105 59.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:27:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23564-PA 732 GM23564-PA 292..732 12..452 2386 98.9 Plus
Dsec\GM26492-PA 549 GM26492-PA 39..377 90..424 1108 60.2 Plus
Dsec\GM17065-PA 442 GM17065-PA 95..432 79..419 600 34.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:27:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18380-PA 523 GD18380-PA 83..523 12..452 2388 99.1 Plus
Dsim\GD21006-PA 549 GD21006-PA 39..377 90..424 1108 60.2 Plus
Dsim\GD21812-PA 442 GD21812-PA 95..432 79..419 604 34.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23123-PA 457 GJ23123-PA 60..457 58..452 1956 90.5 Plus
Dvir\GJ24053-PA 550 GJ24053-PA 24..362 90..424 1114 60.8 Plus
Dvir\GJ17200-PA 443 GJ17200-PA 96..421 91..415 581 35.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13155-PA 436 GK13155-PA 1..436 16..452 2312 97.3 Plus
Dwil\GK14058-PA 512 GK14058-PA 1..339 90..424 1111 60.2 Plus
Dwil\GK12266-PA 521 GK12266-PA 12..348 92..424 1082 59.3 Plus
Dwil\GK18176-PA 453 GK18176-PA 111..432 91..415 598 36.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Irk2-PA 669 GE23953-PA 229..669 12..452 2378 98.6 Plus
Dyak\GE10360-PA 553 GE10360-PA 39..377 90..424 1109 60.2 Plus
Dyak\GE12711-PA 439 GE12711-PA 105..436 92..428 587 34 Plus

FI04664.hyp Sequence

Translation from 3 to 1358

> FI04664.hyp
FSFVQNREVKTSREMQVPLSDVQVLQDPTDAETLVGGDKEETFAHMKEWK
RQYMRGISHTPSQAGVYYEALKGSSHSLAKGSRNFRPGSMRRVRRRAVFK
NGDCNVVQKHLQRRRVRFLQDMYTTMVDWQWRWTLLAFALSFILSWLFFA
LIWWLIIYTHGDLEEPHLPENQEESGWAPCVSAIDGFTSCFLFSIETQHT
IGYGVRTTSPECPEAIFMMCFQSIYGVMSSAFMAGIVFAKMTRAKQRAQT
LLFSKHAVICQRDGTLSLMFRVGDMRKSHIIGAGVRAQLIRTKSTKEGEV
MTQYFTELEIGTDDSGSDLFFIWPMVIEHKIDENSPLYNLNATDMLQDKF
EIVVILEGTVESTGQSTQARSSYINTEILWGHRFDPVVLYNKDLQAYEID
YARFNETTQVDTPLCSARELNEIYKIQEGFRTPETTFTMRQLSHNHSDQA
S*

FI04664.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
Irk2-PB 437 CG4370-PB 1..437 15..451 2308 100 Plus
Irk2-PC 451 CG4370-PC 1..429 15..443 2219 98.1 Plus
Irk2-PA 453 CG4370-PA 84..453 82..451 1957 100 Plus
Irk2-PD 454 CG4370-PD 84..454 82..451 1945 99.7 Plus
Irk1-PB 555 CG44159-PB 14..377 66..423 1069 57.4 Plus