Clone FI04720 Report

Search the DGRC for FI04720

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:47
Well:20
Vector:pFlc-1
Associated Gene/TranscriptOsi15-RA
Protein status:FI04720.pep: gold
Sequenced Size:1246

Clone Sequence Records

FI04720.complete Sequence

1246 bp assembled on 2009-10-19

GenBank Submission: BT100122.1

> FI04720.complete
ATCACAAAGCGATTCCCGTTCACATCGGCAGCACTCACCAGCTCCAGGCA
GCCGTCCCACGGATTATAACCTACCCAAAGTCAAGACACCCCCAAGTGCT
AATAAAAATGTGCGCGAAATTCGTATGTGTAGTGCTGCTGGCCAGCCTTG
TGTGCGGTTCCATGGCCCTTCCCTCCCAGGACAACACCGAGCGGGACCTG
GTCAACATGCTGAACCGCTTAGACAGCGAGGAGTCCGTCGCGCTGTTCGG
CGGTCTGAGGATCGACCGGTCGGAGTCGGGCCGTAGCTTCGGTGCATCCA
AGGCCGTCGAGTCCTTCGAGGACCGCGCCGAGCGCTACCTGGAGACCCAC
GAGCTAAACCTCTCCTTCTCCGGCGATGAGCAGGACGAGAACTCCGAGAA
CGAGTACACCGGACGCGCCATGGATGAGTCCCGCAGCAAGCGCATGAAGA
AGATGCTGCTGCCCCTTCTTTTGGCCCTGAAGCTGAAGAAGGCCGTCGTT
GTCAAGATTATGTTCACCATCATCAAGTTCATCTCGCTGAAGGCTCTGGC
CATCTCCTTCCTGGCCCTCATCCTGGCTGGTGCCACCTTCTTCAAGGATC
TGTTGGCCAAGAAGAAGGAACACATCACCACTGCCTACATCACCGGCAGC
CCGCTGAACGCCGACATCGTGCACTCCGACTGGAGCCGCAATGGTCAGGC
AGGTGCCGCCGATCTGGCCTACAACCACTATGGTCTGGCCCAGCCCTTCT
AAGCCGGAAAACACCCACCGATCCATCCATCCCACTCTGTACTAGCCTCT
ATCTTTCACCTGCTATATCTTATCCTACCAAAGCGTCTCCCTTCTTCAAC
TTCCCCCCACTTCATCACCATTTCCACAACCTATCCCTCTAAGACTTTCC
TGAAGAATGGCCTAATTCGTAGTCAATAATTATTTAGTTACATTTAGTTA
GTTAGCTGCGACATACCAAAAAAAATCACAAAAAAAGAGAACTATTGAAA
CGGTCCCTCGACTCTTGGCTAGCCCAAAGGACAATGCTTAAGGATACTAC
GGCCAATCAATGATTGCGCCATAATTATTGCACATTTCCCCATCCACATG
TCTCTTGGCGGTCGTACATGTCACTCAGGTTCATCGAAAGCAACGAAGAT
TATGCCTGCTAAAGAGCTTACTTACTAAGTATTTATTCGTACAACTTAAA
GCAATTGAATAAAAATGATTCATCAAATGCAAAAAAAAAAAAAAAA

FI04720.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
Osi15.a 2178 Osi15.a 114..1347 1..1234 6170 100 Plus
Osi15-RA 1398 Osi15-RA 114..1347 1..1234 6170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2128678..2129329 579..1230 3260 100 Plus
chr3R 27901430 chr3R 2127482..2127907 1..426 2115 99.8 Plus
chr3R 27901430 chr3R 2128467..2128623 426..582 785 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
Osi15-RA 645 CG1157-PA 1..645 108..752 3225 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:37 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
Osi15-RA 1232 CG1157-RA 3..1232 1..1230 6150 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Osi15-PA 214 CG1157-PA 1..214 108..749 846 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6303002..6303657 579..1234 3280 100 Plus
3R 32079331 3R 6301806..6302231 1..426 2130 100 Plus
3R 32079331 3R 6302791..6302947 426..582 785 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6043833..6044488 579..1234 3280 100 Plus
3R 31820162 3R 6042637..6043062 1..426 2130 100 Plus
3R 31820162 3R 6043622..6043778 426..582 785 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:10:59 has no hits.

FI04720.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:29:46 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2128679..2129329 580..1230 100   Plus
chr3R 2128468..2128620 427..579 100 -> Plus
chr3R 2127482..2127907 1..426 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:58:42 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
Osi15-RA 1..645 108..752 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:45:38 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
Osi15-RA 1..645 108..752 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:59 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
Osi15-RA 1..645 108..752 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:29:46 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
Osi15-RA 1..645 108..752 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-19 14:06:39 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
Osi15-RA 1..1230 1..1230 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:45:38 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
Osi15-RA 1..1230 1..1230 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:59 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
Osi15-RA 3..1232 1..1230 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:29:46 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
Osi15-RA 3..1232 1..1230 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:29:46 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6303003..6303653 580..1230 100   Plus
3R 6302792..6302944 427..579 100 -> Plus
3R 6301806..6302231 1..426 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:59 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2128725..2129375 580..1230 100   Plus
arm_3R 2128514..2128666 427..579 100 -> Plus
arm_3R 2127528..2127953 1..426 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:26:00 Download gff for FI04720.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6043834..6044484 580..1230 100   Plus
3R 6043623..6043775 427..579 100 -> Plus
3R 6042637..6043062 1..426 100 -> Plus

FI04720.pep Sequence

Translation from 2 to 751

> FI04720.pep
HKAIPVHIGSTHQLQAAVPRIITYPKSRHPQVLIKMCAKFVCVVLLASLV
CGSMALPSQDNTERDLVNMLNRLDSEESVALFGGLRIDRSESGRSFGASK
AVESFEDRAERYLETHELNLSFSGDEQDENSENEYTGRAMDESRSKRMKK
MLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFLALILAGATFFKDL
LAKKKEHITTAYITGSPLNADIVHSDWSRNGQAGAADLAYNHYGLAQPF*

FI04720.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16387-PA 214 GF16387-PA 1..214 36..249 946 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13226-PA 214 GG13226-PA 1..214 36..249 984 97.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14031-PA 214 GH14031-PA 1..214 36..249 982 86.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
Osi15-PA 214 CG1157-PA 1..214 36..249 1069 100 Plus
Osi9-PA 233 CG15592-PA 3..197 39..207 155 30.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24404-PA 214 GI24404-PA 1..214 36..249 898 86 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24068-PA 214 GL24068-PA 1..214 36..249 930 91.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11070-PA 214 GA11070-PA 1..214 36..249 930 91.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10877-PA 214 GM10877-PA 1..214 36..249 1118 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19858-PA 214 GD19858-PA 1..214 36..249 1121 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14262-PA 215 GJ14262-PA 1..215 36..249 938 88.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13045-PA 214 GK13045-PA 1..214 36..249 957 90.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10199-PA 214 GE10199-PA 1..214 36..249 977 95.8 Plus

FI04720.hyp Sequence

Translation from 2 to 751

> FI04720.hyp
HKAIPVHIGSTHQLQAAVPRIITYPKSRHPQVLIKMCAKFVCVVLLASLV
CGSMALPSQDNTERDLVNMLNRLDSEESVALFGGLRIDRSESGRSFGASK
AVESFEDRAERYLETHELNLSFSGDEQDENSENEYTGRAMDESRSKRMKK
MLLPLLLALKLKKAVVVKIMFTIIKFISLKALAISFLALILAGATFFKDL
LAKKKEHITTAYITGSPLNADIVHSDWSRNGQAGAADLAYNHYGLAQPF*

FI04720.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
Osi15-PA 214 CG1157-PA 1..214 36..249 1069 100 Plus
Osi9-PA 233 CG15592-PA 3..197 39..207 155 30.3 Plus