Clone FI04761 Report

Search the DGRC for FI04761

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:47
Well:61
Vector:pFlc-1
Associated Gene/Transcriptdpr4-RB
Protein status:FI04761.pep: gold
Sequenced Size:3009

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
dpr4 2008-12-18 5.12 accounting

Clone Sequence Records

FI04761.complete Sequence

3009 bp assembled on 2008-09-26

GenBank Submission: BT057996.1

> FI04761.complete
AGTTCCAGCACGCGAATCCTGATGCAAGGATGCCCGTGAACGCTGCTCCG
TTGTTGCCGTCGGATAAATCACTCATACGGGAAGGGAAGCACCGGGAAAA
GGGAAAGTGCTAGCAGAAGCAGCAGGAGCAGCAACACCATCGCCACATAG
CATTGTGCCACATTTAAAAATGAAAACAGACGAAGGAATGAAGTGAAGGC
AGAAGCCAAAAGCCGTTTAATAACTAAATCCCACGGACCCATCGTTGGTC
ACGTTCTGAGACGGATACACAAAATGCCTCTCTCCGCGTATCCTTCGAAC
TTGTGTGTGTGTGCGTCAGTAACTGTGACTGTGTCTGTGTGCTTCCCTCT
GTCTCAGTGTAAGTGTGCATACCTATAGGGCTCTGGCTGGCACCTAATGT
GGCCAACATACACATACGCACTTTGCCGACTAAACGAATATAATAATACA
AAGCACACGTCCTTGTCGCTCAACTCGCTGTCATCGTGTGCGTGCGTGTC
CGTGGATCCATGTGTCCATGTGTCCACTTCCGCCGAACGGATATATTTTC
GAAATCCGCGCTATTAAGTAAGCCAGTAAGCCAGACCAGAAATAAACCTG
TGTTTGCGATTGGGCCACTTTTTTGACCATTGTTGAACCGAATTGATTGG
TGAACTGTGACGTTGGTGAATTGTTGCGGCATTGTTGAATGCCAATCGTT
ATTGTGCAACTGTTGAATGAGCCATGCCAGCAGGCCCGCCTAATTATTGC
GCATTGCGCAACCGAATGTCAAAGCCAAGATCGAGTGTAACGCAGTTGTA
AAATCACAGAGCTCAAGGATTTTGCCCGTTTGGATTACGCAGAGGATGAC
GGTGGTGTCATTTGGAAGTCATTGCCGAGACCCATTATTAAACCTTAAAC
CGTAAACGGAGCAAATACAACAGCCGGCAGGAGCGGAGGATTCCTCATCG
CCCTCATCGAAGTAGCTAGCAGCCGTAGTAGCAGTCCGAGTGGAAAGCAT
AAAACATGTGGACAACGGACTGCCCGAGAGCGTTGAAAGCGATTTGCTTG
GTGCCGCTGTGGCTGCTCCTCTTCCTCGATTGCGGCATGGTCGGTGGCGA
GGTGCCGCCGCATTACTGGGAAACCCCGTACTCGCAGCCGTACTTCGACA
ACTCCTCGAGGCGTGAGGTCACCGCAACCGTCGGCCAGGCGGCCCTGCTG
CACTGCCGCGTCCGGAATCTGGGCGATCGAGCGGTGTCCTGGATAAGGAA
GCGCGACCTGCACATCCTGACGGTGGGAATACTAACGTACACAAACGACC
AGCGCTTCCAGTCGCTGCACTCCGAGGGATCCGACGAGTGGACGCTGCGC
ATCTCATCGCCGCAGCCGCGGGATTCGGGCACCTACGAGTGCCAGGTGTC
CACGGAGCCGAAGATCAGCCAAGGATTTCGCCTCAACGTTGTGGTGTCAC
GGGCCAAGATCCTGGGCAACGCGGAGCTCTTCATCAAGAGCGGCAGCGAC
ATCAATCTCACCTGCCTGGCGATGCAGTCGCCGGTGCCGCCATCGTTCAT
CTACTGGTACAAGGGCAAGCGGGTCATGAATTACTCGCAGCGCGGTGGCA
TCAACGTCATCACGGAGCGTTCCACACGGACCAGCAAGCTGCTCATAGCC
AAGGCCACGCCGGCGGATTCGGGCAACTACACGTGCTCCCCGAGCAGCTC
AGATTCTGCCTCCGTGGTGGTGCACGTCATCAACGGGGAACATCCGGCCG
CCATGCAGCACGGCAACAGCAGCGCCACCTGCCTGCGCCCCCTTTCATCC
ACGTCCGTGCCTTTCGTCCTTGCCACCTGGATGTCGATGACGGTGGCGTC
TGTCGCCTGGAACTCTAACCTCAACATCAACTGGAACTGGAGCCCCGACT
GGCGCTGGCACTGGAACCCTAAATGGAATTGGAGCAACCTGGCCGCCGGT
CTAGTGGGCATCTGGAGCTGGAGCTGATCCGGAAGGCAGTTGCATTGACA
GTCGAAGATCGAAAACGCTGAGCAACAGTCCCGGCCAAGTTGGGACTGAA
CCACTCCTCGCCAGGTGCATTTAATGAGAGCGGCGGTGGAGCGAAGTCTT
ACGAACTAGTGTACATATACAGTGTGTCCTTCAACGAGTATTATCTATAA
GACAGGTAGGCTGGCAGGCAGGCAGGCAGTATTACGCAAGGAGTTTTAAT
CAACCACAGTCAACAGAAAGAGTCCAGGCCACATGCACTATTCATACTCA
TAGTTGGAAAAATTAATGAGAAAGTATAACGTAACAAAATCGCAGCAGCT
GCTGTTCAACCCAAAAATCAGTGTTTTCATTGTATATCATTGAAATTCAT
TTCGCTTTTGCACACAGGGCTATAATCACCGCAAAACCGGCCAAAAGTCA
GCAATTATAGAGAACCTTTCGGTTTACAGTATCATTTGGGTTTATTGAAG
CAGAAATGTCCGATTGTATATATACAATACACAAACATAAATAATTTAGG
CCCTCGATTGTTTATTTATTCATACCGAAATCAAACACCCTGCACGTTGG
GAACTGAAATGAATGAAGTGAATAGATGGGGAGGTTAGCCCCCTCTATAT
TTATATATACATATATATATATATATATATAGATGGTTATTCAGTGTATA
TGGATAAGTTTTTATCTGGTTGTCAACCGCAAAATTGTTCTACGTAGTCC
ATCATCTAGTTACTGTGTAAAATATTCATAATTGATAATTGTACATTTAG
AGGTCGGTTTTAAGCGGTCTTGATAAGACTTTTAAGCAGTAAGTGCGAAC
GGATCGATTCGATCGCGTTTCAACCCAAAACCAAATAGCGAAAAAAAGGA
AAAACTTACAGAAATTATTAAAACTAACGAAAAATGGTAATGAAGCTAGC
CTAAGCGGAGTCAAGTATGTTTTTCTGTTTAAACAATGCAAAAATAAACG
AACAATGTTTCTCCATAATAAATGAAAATATAGTTATGGTTACAAAAAAA
AAAAAAAAA

FI04761.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
dpr4-RB 3023 dpr4-RB 30..3023 1..2993 14915 99.9 Plus
dpr4-RC 1841 dpr4-RC 80..1841 1233..2993 8770 99.9 Plus
dpr5-RB 1428 dpr5-RB 302..442 1201..1341 195 75.8 Plus
dpr5-RB 1428 dpr5-RB 463..519 1362..1418 180 87.7 Plus
dpr5-RB 1428 dpr5-RB 558..616 1457..1515 160 84.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7358966..7360260 2993..1700 6410 99.8 Minus
chr3R 27901430 chr3R 7367549..7368431 883..1 4370 99.7 Minus
chr3R 27901430 chr3R 7361066..7361324 1702..1444 1295 100 Minus
chr3R 27901430 chr3R 7361452..7361663 1444..1233 1045 99.5 Minus
chr3R 27901430 chr3R 7365389..7365583 1078..884 960 99.5 Minus
chr3R 27901430 chr3R 7364581..7364738 1235..1078 790 100 Minus
chr3R 27901430 chr3R 7329017..7329234 1201..1418 310 76.1 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
dpr4-RB 972 CG33512-PB 1..972 1006..1977 4860 100 Plus
dpr5-RB 897 CG5308-PB 217..531 1201..1515 330 73.7 Plus
dpr5-RA 1011 CG5308-PA 331..645 1201..1515 330 73.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:40 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
dpr4-RB 2994 CG33512-RB 1..2994 1..2993 14905 99.9 Plus
dpr5-RB 1419 CG5308-RB 302..616 1201..1515 330 73.7 Plus
dpr5-RA 1817 CG5308-RA 700..1014 1201..1515 330 73.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
dpr4-PB 323 CG33512-PB 1..323 1006..1974 1588 100 Plus
dpr5-PB 298 CG5308-PB 52..286 1138..1842 623 56.2 Plus
dpr5-PA 336 CG5308-PA 90..324 1138..1842 623 56.2 Plus
dpr6-PC 390 CG14162-PC 65..285 1114..1770 574 56.1 Plus
dpr-PB 367 CG13439-PB 53..272 1138..1773 561 54.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11533470..11534777 3006..1700 6490 99.9 Minus
3R 32079331 3R 11542067..11542949 883..1 4415 100 Minus
3R 32079331 3R 11535583..11535841 1702..1444 1295 100 Minus
3R 32079331 3R 11535969..11536180 1444..1233 1060 100 Minus
3R 32079331 3R 11539907..11540101 1078..884 960 99.5 Minus
3R 32079331 3R 11539099..11539256 1235..1078 790 100 Minus
3R 32079331 3R 11503537..11503754 1201..1418 310 76.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11274301..11275608 3006..1700 6500 99.9 Minus
3R 31820162 3R 11282898..11283780 883..1 4415 100 Minus
3R 31820162 3R 11276414..11276672 1702..1444 1295 100 Minus
3R 31820162 3R 11276800..11277011 1444..1233 1060 100 Minus
3R 31820162 3R 11280738..11280932 1078..884 960 99.4 Minus
3R 31820162 3R 11279930..11280087 1235..1078 790 100 Minus
3R 31820162 3R 11244368..11244508 1201..1341 195 75.8 Plus
3R 31820162 3R 11244529..11244585 1362..1418 180 87.7 Plus
3R 31820162 3R 11245138..11245196 1457..1515 160 84.7 Plus
Blast to na_te.dros performed 2014-11-27 11:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6810..6906 88..180 123 64.3 Plus

FI04761.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 12:53:37 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7367549..7368431 1..883 99   Minus
chr3R 7365389..7365583 884..1078 99 <- Minus
chr3R 7364583..7364737 1079..1233 100 <- Minus
chr3R 7361452..7361662 1234..1444 99 <- Minus
chr3R 7361066..7361323 1445..1702 100 <- Minus
chr3R 7358966..7360257 1703..2993 94 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:49:02 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RA 1..891 1087..1977 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:13:55 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RB 1..972 1006..1977 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:30:32 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RB 1..972 1006..1977 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:53:37 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RB 1..972 1006..1977 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:52:04 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RA 1..891 1087..1977 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:13:55 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RB 1..2994 1..2993 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:32 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RB 1..2994 1..2993 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-29 18:10:56 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RA 1..891 1087..1977 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:53:37 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
dpr4-RB 1..2994 1..2993 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 12:53:37 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11542067..11542949 1..883 100   Minus
3R 11539907..11540101 884..1078 99 <- Minus
3R 11539101..11539255 1079..1233 100 <- Minus
3R 11535969..11536179 1234..1444 100 <- Minus
3R 11535583..11535840 1445..1702 100 <- Minus
3R 11533483..11534774 1703..2993 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:32 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7367789..7368671 1..883 100   Minus
arm_3R 7365629..7365823 884..1078 99 <- Minus
arm_3R 7364823..7364977 1079..1233 100 <- Minus
arm_3R 7361691..7361901 1234..1444 100 <- Minus
arm_3R 7361305..7361562 1445..1702 100 <- Minus
arm_3R 7359205..7360496 1703..2993 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:44:33 Download gff for FI04761.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11282898..11283780 1..883 100   Minus
3R 11280738..11280932 884..1078 99 <- Minus
3R 11279932..11280086 1079..1233 100 <- Minus
3R 11276800..11277010 1234..1444 100 <- Minus
3R 11276414..11276671 1445..1702 100 <- Minus
3R 11274314..11275605 1703..2993 99 <- Minus

FI04761.pep Sequence

Translation from 1005 to 1976

> FI04761.pep
MWTTDCPRALKAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNS
SRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQR
FQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRA
KILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGIN
VITERSTRTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAM
QHGNSSATCLRPLSSTSVPFVLATWMSMTVASVAWNSNLNINWNWSPDWR
WHWNPKWNWSNLAAGLVGIWSWS*

FI04761.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 19:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16640-PA 347 GF16640-PA 1..347 1..323 1200 80.2 Plus
Dana\GF18374-PA 287 GF18374-PA 51..259 44..252 712 61.2 Plus
Dana\GF12197-PA 374 GF12197-PA 53..268 45..252 616 54.6 Plus
Dana\GF22561-PA 362 GF22561-PA 5..259 19..262 586 46.3 Plus
Dana\GF10587-PA 328 GF10587-PA 73..289 44..246 578 53.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 19:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17217-PA 323 GG17217-PA 1..323 1..323 1525 96.9 Plus
Dere\GG18200-PA 335 GG18200-PA 90..297 45..252 693 60.6 Plus
Dere\GG22056-PA 374 GG22056-PA 53..268 45..252 613 54.2 Plus
Dere\GG15427-PA 277 GG15427-PA 72..275 44..245 591 56.4 Plus
Dere\GG17844-PA 346 GG17844-PA 42..254 45..255 558 48.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 19:35:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15335-PA 327 GH15335-PA 29..259 24..254 1119 97.4 Plus
Dgri\GH17326-PA 302 GH17326-PA 44..257 33..252 720 59.1 Plus
Dgri\GH16056-PA 380 GH16056-PA 65..278 44..255 636 57.9 Plus
Dgri\GH21996-PA 366 GH21996-PA 55..270 45..252 602 53.2 Plus
Dgri\GH11687-PA 385 GH11687-PA 79..360 36..296 562 45.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
dpr4-PB 323 CG33512-PB 1..323 1..323 1758 100 Plus
dpr5-PB 298 CG5308-PB 52..286 45..279 670 56.2 Plus
dpr5-PA 336 CG5308-PA 90..324 45..279 670 56.2 Plus
dpr6-PC 390 CG14162-PC 65..285 37..255 631 56.1 Plus
dpr6-PF 396 CG14162-PF 65..291 37..255 614 54.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 19:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22455-PA 326 GI22455-PA 28..267 24..263 1137 95.4 Plus
Dmoj\GI10290-PA 293 GI10290-PA 44..252 44..252 707 60.8 Plus
Dmoj\GI19698-PA 342 GI19698-PA 26..241 45..252 608 53.7 Plus
Dmoj\GI12319-PA 332 GI12319-PA 57..261 44..246 599 56.6 Plus
Dmoj\GI17133-PA 408 GI17133-PA 102..360 39..285 550 46.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 19:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12265-PA 225 GL12265-PA 33..225 25..215 903 89.6 Plus
Dper\GL12378-PA 332 GL12378-PA 100..307 45..252 698 60.1 Plus
Dper\GL12584-PA 282 GL12584-PA 72..276 44..246 597 56.6 Plus
Dper\GL21695-PA 638 GL21695-PA 290..495 45..244 554 51 Plus
Dper\GL19023-PA 379 GL19023-PA 70..327 39..280 539 47.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 19:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13190-PA 319 GA13190-PA 33..319 25..323 1186 83.5 Plus
Dpse\GA18796-PB 291 GA18796-PB 59..266 45..252 698 60.1 Plus
Dpse\GA18796-PA 335 GA18796-PA 103..310 45..252 698 60.1 Plus
Dpse\GA23478-PA 282 GA23478-PA 72..276 44..246 597 56.6 Plus
Dpse\GA26372-PB 642 GA26372-PB 293..498 45..244 554 51 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 19:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26095-PA 323 GM26095-PA 1..323 1..323 1664 96.9 Plus
Dsec\GM23950-PA 336 GM23950-PA 90..297 45..252 688 60.6 Plus
Dsec\GM22039-PA 377 GM22039-PA 53..268 45..252 612 54.2 Plus
Dsec\GM25200-PA 312 GM25200-PA 72..289 44..250 595 54.6 Plus
Dsec\GM17677-PA 344 GM17677-PA 42..254 45..255 561 49.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 19:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20657-PA 323 GD20657-PA 1..323 1..323 1669 97.2 Plus
Dsim\GD11536-PA 377 GD11536-PA 53..268 45..252 611 54.2 Plus
Dsim\GD14231-PA 380 GD14231-PA 129..336 44..249 601 56.2 Plus
Dsim\GD17172-PA 345 GD17172-PA 42..254 45..255 561 49.3 Plus
Dsim\GD20388-PA 485 GD20388-PA 145..350 45..244 554 51 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 19:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10053-PA 332 GJ10053-PA 33..265 29..261 1123 97.9 Plus
Dvir\GJ11097-PA 326 GJ11097-PA 81..289 44..252 716 61.7 Plus
Dvir\GJ17343-PA 354 GJ17343-PA 49..264 45..252 606 53.7 Plus
Dvir\GJ13257-PA 320 GJ13257-PA 65..267 44..244 592 56.7 Plus
Dvir\GJ16171-PA 388 GJ16171-PA 82..343 39..285 553 46.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 19:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11789-PA 341 GK11789-PA 2..287 3..296 1216 85.8 Plus
Dwil\GK11299-PA 336 GK11299-PA 89..296 45..252 695 59.6 Plus
Dwil\GK11007-PA 579 GK11007-PA 278..492 45..253 605 52.6 Plus
Dwil\GK17458-PA 308 GK17458-PA 70..271 44..243 589 56.9 Plus
Dwil\GK10319-PA 302 GK10319-PA 32..213 77..256 501 51.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 19:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24616-PA 324 GE24616-PA 1..324 1..323 1502 96 Plus
Dyak\GE26101-PA 341 GE26101-PA 90..297 45..252 691 60.6 Plus
Dyak\GE21735-PA 390 GE21735-PA 72..285 44..255 634 57.5 Plus
Dyak\GE12137-PA 376 GE12137-PA 53..268 45..252 613 54.2 Plus
Dyak\GE17141-PA 344 GE17141-PA 42..260 45..258 561 49.3 Plus

FI04761.hyp Sequence

Translation from 1005 to 1976

> FI04761.hyp
MWTTDCPRALKAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNS
SRREVTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQR
FQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRA
KILGNAELFIKSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGIN
VITERSTRTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPAAM
QHGNSSATCLRPLSSTSVPFVLATWMSMTVASVAWNSNLNINWNWSPDWR
WHWNPKWNWSNLAAGLVGIWSWS*

FI04761.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
dpr4-PB 323 CG33512-PB 1..323 1..323 1758 100 Plus
dpr5-PB 298 CG5308-PB 52..286 45..279 670 56.2 Plus
dpr5-PA 336 CG5308-PA 90..324 45..279 670 56.2 Plus
dpr6-PC 390 CG14162-PC 65..285 37..255 631 56.1 Plus
dpr6-PF 396 CG14162-PF 65..291 37..255 614 54.6 Plus