Clone FI04779 Report

Search the DGRC for FI04779

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:47
Well:79
Vector:pFlc-1
Associated Gene/TranscriptHBS1-RA
Protein status:FI04779.pep: gold
Sequenced Size:2269

Clone Sequence Records

FI04779.complete Sequence

2269 bp assembled on 2009-12-14

GenBank Submission: BT120040.1

> FI04779.complete
ACGTACCTTTATTATTTTTGATGAAATTCTGACCCTGCTCCGTAAATTGT
GAAATACAGAGTCCTCCAAAATGTCGCGGCACAGGATAGTGCGCACCATG
GACTACAATGATGAGTACGACGGCTACGACGACATCTACGGGCACTCCGT
GGAGGACGAGCACTGCATCTCGCCCACGGATGCCCAGCAATGGCTCTACG
ATCGGGCTCGTGGCCAGCAGAGCATCTCGGCGTTCATCAGCAAGAACAAG
GACATCCAAGAGGAGGAGGCCGACGAGGATGAGGACGAGGACGCCGCCTT
CGCCAAGGCTCGCCGCGACTCCGAGAGCTTCCAAATGCCGCAACTGGACG
AGATCGAGCAGGCCAAGCTGAGCTCCTGCGTGGACGAGGTGCGCAGCGTG
GTGGGCGATGCCGTCTCCGAGCGCCGCATCGTGGAGACATCCATGAAATT
CGACTATGACATGCAGAAGATCCTGGACGAGATCCTCAACGAAGAGACCA
ACAAGTCTGCCAAGCCGGCTGTGAATAAGATGAAAGCGCCCGCTGCTCCA
GTGCTGCCAAAGACGGTCAGCAAAACGGTGCCTACGCCACCACCCAAGAT
CAGCCTTAAAGAGCCGCGACGTGGCTTCGAAATACCCTCGCCCAAGGTGC
CCTCATCGCCTGTGGTCTCGGGCAGAAACACACCCGTTGACATTAGCGCC
GGCGACGACATCTCCCGTAGCTCAGCAACCGTTTTCAAGGTCTCCAAGGA
ACAGGCCGTGCGCAATGCCCGCCAGCTGTACGAGAAGGAGCGAGCCGACC
AGAAGAGCCACATTCACATGATTGTCATTGGTCACGTCGACGCCGGGAAG
AGTACGCTGATGGGCCATCTACTGTACGACACCGGCAACGTTTCGCAGCG
AGTGATGCACAAGCACGAGCAGGAGTCCAAGAAGCTGGGCAAGCAGAGCT
TCATGTATGCCTGGGTGCTGGACGAGACGGGCGAGGAGCGGGCCCGCGGC
ATCACCATGGACGTGGGCCAGTCGCGTATCGAAACCAAGACCAAGATCGT
CACACTGCTGGATGCTCCGGGGCACAAGGACTTCATTCCGAACATGATCT
CCGGTGCCACACAGGCGGATGTTGCCCTTCTGGTGGTGGATGCTACAAGG
GGAGAGTTTGAATCCGGCTTTGAGCTCGGCGGACAGACTAGAGAGCACGC
CATTCTAGTGCGATCCCTGGGGGTTAACCAGCTAGGCGTGGTCATCAACA
AGCTGGACACCGTTGGCTGGTCCCAGGACCGATTCACAGAGATTGTGACC
AAGCTAAAGTCCTTCCTCAAACTGGCGGGCTTCAAGGATTCCGATGTGAG
TTTTACGCCCTGTTCCGGACTAACCGGCGAGAACCTCACCAAGAAAGCCC
AGGAACCCGCCCTGACCAACTGGTACAGTGGACGCCACCTCCTCGATGTC
ATTGAGAACTTCAAGATCCCCGAAAGAGCCATCGACAGACCGCTGCGAAT
GTCCGTGTCGGACATTTACAAGGGCACTGGCTCCGGATTCTGCATCTCGG
GACGAGTGGAAACCGGAGTGCTGTGCCTGAACGACAAGGTGCTGGTGGGT
GCCAGCCGGGAGCAGGCCCAAGTGAAATCCCTTACCATGAACGAATTCCC
ACAGACTTGCGTGTTCGCCGGCGATCAGGTCTCCGTCACCCTGCCCGCCT
TGGACATCAACAACGTCACCGTGGGCTGCATCATCAGCGATCCACAAACC
CCTATTCCGGTGACAACGCGATTCCAGGCCCGCATAATCGTGTTCAACGT
CAAGGTGCCCATTACCATGGGCTTCCCCGTGCTGCTGCACCACCAATCCC
TAATAGAGCCCGCCGTGGTCTGCAAGCTGACCGCATCGATTCACAAGAGC
ACCGGCGAGGTGGTCAAGAAGAAGCCGCGTTGCCTGGGCAACAACTCGTG
TGCCCTAGTGGAACTGGAAACCAGCAGACCCATCTGCATCGAGCGGTATG
CGGACTTCAAGGAGCTGGGACGCGTGATGCTTCGCGTGGCGGGAGTCACC
ATTGCCGCCGGAATGGTCACCAAGATCCGCTAGGTCGATGACCGCGCTGG
ATTTTGTACGAAATTTTAGTTAGATATTAACTTTTGTTGATTTCCTAAAT
ATACATAGTTTATATGAATTGATTAAATCGAAAAGACGCTGAAGCATTGG
AAGAGATTTCGGTCTGACCATTTTAGCGGTATCTTAAAAAAAAAAAAAAA
AATAAAAAAAAAAAAAAAA

FI04779.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
HBS1-RA 2427 HBS1-RA 195..2427 1..2233 11150 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1862440..1864677 2238..1 11175 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
HBS1-RB 2013 CG1898-PB 1..2013 71..2083 10065 100 Plus
HBS1-RA 2013 CG1898-PA 1..2013 71..2083 10065 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:13:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
HBS1-RB 2360 CG1898-RB 126..2360 1..2235 11160 100 Plus
HBS1-RA 2259 CG1898-RA 25..2259 1..2235 11160 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
HBS1-PB 670 CG1898-PB 1..670 71..2080 3170 100 Plus
HBS1-PA 670 CG1898-PA 1..670 71..2080 3170 100 Plus
Elf-PC 495 CG6382-PC 34..493 680..2077 796 36.9 Plus
Elf-PB 619 CG6382-PB 158..617 680..2077 796 36.9 Plus
Elf-PD 619 CG6382-PD 158..617 680..2077 796 36.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1862878..1865115 2238..1 11175 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1862878..1865115 2238..1 11175 99.9 Minus
Blast to na_te.dros performed 2014-11-27 03:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Dv 845 Dvir\Dv DVRPPDV 845bp Derived from X03936 (Rel. 20, Last updated, Version 1). 181..217 2143..2107 122 81.1 Minus

FI04779.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:53:40 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1862443..1864677 1..2235 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-12-14 11:37:28 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
HBS1-RA 1..2013 71..2083 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:28:38 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
HBS1-RA 1..2013 71..2083 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:12 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
HBS1-RA 1..2013 71..2083 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:53:40 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
HBS1-RA 1..2013 71..2083 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-14 11:37:28 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
HBS1-RA 195..2427 1..2233 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:28:38 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
HBS1-RA 195..2429 1..2235 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:12 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
HBS1-RA 25..2259 1..2235 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:53:40 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
HBS1-RA 25..2259 1..2235 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:53:40 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1862881..1865115 1..2235 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:12 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1862881..1865115 1..2235 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:14:24 Download gff for FI04779.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1862881..1865115 1..2235 99   Minus

FI04779.pep Sequence

Translation from 70 to 2082

> FI04779.pep
MSRHRIVRTMDYNDEYDGYDDIYGHSVEDEHCISPTDAQQWLYDRARGQQ
SISAFISKNKDIQEEEADEDEDEDAAFAKARRDSESFQMPQLDEIEQAKL
SSCVDEVRSVVGDAVSERRIVETSMKFDYDMQKILDEILNEETNKSAKPA
VNKMKAPAAPVLPKTVSKTVPTPPPKISLKEPRRGFEIPSPKVPSSPVVS
GRNTPVDISAGDDISRSSATVFKVSKEQAVRNARQLYEKERADQKSHIHM
IVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVL
DETGEERARGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQAD
VALLVVDATRGEFESGFELGGQTREHAILVRSLGVNQLGVVINKLDTVGW
SQDRFTEIVTKLKSFLKLAGFKDSDVSFTPCSGLTGENLTKKAQEPALTN
WYSGRHLLDVIENFKIPERAIDRPLRMSVSDIYKGTGSGFCISGRVETGV
LCLNDKVLVGASREQAQVKSLTMNEFPQTCVFAGDQVSVTLPALDINNVT
VGCIISDPQTPIPVTTRFQARIIVFNVKVPITMGFPVLLHHQSLIEPAVV
CKLTASIHKSTGEVVKKKPRCLGNNSCALVELETSRPICIERYADFKELG
RVMLRVAGVTIAAGMVTKIR*

FI04779.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24953-PA 665 GF24953-PA 1..665 1..670 3110 89.2 Plus
Dana\GF14198-PA 634 GF14198-PA 202..632 239..669 801 37.8 Plus
Dana\GF13105-PA 463 GF13105-PA 4..441 244..669 759 37.1 Plus
Dana\GF22982-PA 462 GF22982-PA 4..441 244..669 755 37.3 Plus
Dana\GF13698-PA 489 GF13698-PA 71..384 232..576 301 27.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14552-PA 667 GG14552-PA 1..667 1..670 3413 97.5 Plus
Dere\GG23786-PA 620 GG23786-PA 188..618 239..669 804 37.8 Plus
Dere\GG11826-PA 462 GG11826-PA 4..441 244..669 756 37.3 Plus
Dere\GG20229-PA 463 GG20229-PA 4..441 244..669 751 36.9 Plus
Dere\GG20385-PA 489 GG20385-PA 61..384 225..576 303 27.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15038-PA 678 GH15038-PA 1..678 1..670 2948 82.6 Plus
Dgri\GH10109-PA 620 GH10109-PA 188..618 239..669 809 38 Plus
Dgri\GH18651-PA 462 GH18651-PA 4..441 244..669 756 37.1 Plus
Dgri\GH21478-PA 463 GH21478-PA 4..441 244..669 751 36.9 Plus
Dgri\GH13998-PA 462 GH13998-PA 44..357 232..576 297 26.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
HBS1-PB 670 CG1898-PB 1..670 1..670 3431 100 Plus
HBS1-PA 670 CG1898-PA 1..670 1..670 3431 100 Plus
Elf-PB 619 CG6382-PB 85..617 149..669 806 34.6 Plus
Elf-PD 619 CG6382-PD 85..617 149..669 806 34.6 Plus
Elf-PA 619 CG6382-PA 85..617 149..669 806 34.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16690-PA 670 GI16690-PA 1..670 1..670 2837 79.8 Plus
Dmoj\GI14440-PA 637 GI14440-PA 205..635 239..669 797 37.8 Plus
Dmoj\GI19955-PA 463 GI19955-PA 4..441 244..669 759 37.1 Plus
Dmoj\GI23129-PA 462 GI23129-PA 4..441 244..669 757 37.3 Plus
Dmoj\GI21331-PA 451 GI21331-PA 25..270 227..501 309 31.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24819-PA 668 GL24819-PA 1..668 1..670 3169 87.9 Plus
Dper\GL19348-PA 621 GL19348-PA 189..619 239..669 802 37.6 Plus
Dper\GL23995-PA 462 GL23995-PA 4..441 244..669 755 37.3 Plus
Dper\GL10091-PA 397 GL10091-PA 4..394 244..622 662 36.2 Plus
Dper\GL17405-PA 488 GL17405-PA 70..383 232..576 308 26.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23522-PA 668 GA23522-PA 1..668 1..670 3169 87.9 Plus
Dpse\GA25929-PA 621 GA25929-PA 189..619 239..669 802 37.6 Plus
Dpse\GA25930-PA 476 GA25930-PA 44..474 239..669 792 37.6 Plus
Dpse\GA15055-PA 462 GA15055-PA 4..441 244..669 755 37.3 Plus
Dpse\GA20951-PA 463 GA20951-PA 4..441 244..669 749 36.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14160-PA 670 GM14160-PA 1..670 1..670 3555 98.8 Plus
Dsec\GM26827-PA 595 GM26827-PA 163..593 239..669 800 37.8 Plus
Dsec\GM16446-PA 462 GM16446-PA 4..441 244..669 756 37.3 Plus
Dsec\GM21316-PA 353 GM21316-PA 2..331 352..669 416 31.4 Plus
Dsec\GM21315-PA 128 GM21315-PA 4..82 244..322 234 51.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13431-PA 670 GD13431-PA 1..670 1..670 3562 99.1 Plus
Dsim\GD23839-PA 619 GD23839-PA 187..617 239..669 800 37.8 Plus
Dsim\GD21598-PA 462 GD21598-PA 4..441 244..669 756 37.3 Plus
Dsim\GD10821-PA 461 GD10821-PA 4..439 244..669 745 37.2 Plus
Dsim\GD25199-PA 512 GD25199-PA 9..323 252..595 185 25.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12942-PA 670 GJ12942-PA 1..670 1..670 2899 83.5 Plus
Dvir\GJ16266-PA 639 GJ16266-PA 207..637 239..669 797 37.6 Plus
Dvir\GJ23103-PA 462 GJ23103-PA 4..441 244..669 757 37.3 Plus
Dvir\GJ17887-PA 463 GJ17887-PA 4..441 244..669 755 36.9 Plus
Dvir\GJ19676-PA 487 GJ19676-PA 61..306 227..501 297 30.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10605-PA 698 GK10605-PA 1..698 1..670 3047 83.4 Plus
Dwil\GK15498-PA 640 GK15498-PA 208..638 239..669 803 37.8 Plus
Dwil\GK12116-PA 462 GK12116-PA 4..441 244..669 756 37.3 Plus
Dwil\GK22048-PA 463 GK22048-PA 4..441 244..669 752 36.9 Plus
Dwil\GK15961-PA 488 GK15961-PA 70..383 232..576 303 27.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20906-PA 669 GE20906-PA 1..669 1..670 3433 97.9 Plus
Dyak\GE18589-PA 619 GE18589-PA 187..617 239..669 807 38 Plus
Dyak\GE10959-PA 462 GE10959-PA 4..441 244..669 756 37.3 Plus
Dyak\GE12389-PA 463 GE12389-PA 4..441 244..669 751 37 Plus
Dyak\GE12547-PA 489 GE12547-PA 71..384 232..576 300 27.2 Plus

FI04779.hyp Sequence

Translation from 70 to 2082

> FI04779.hyp
MSRHRIVRTMDYNDEYDGYDDIYGHSVEDEHCISPTDAQQWLYDRARGQQ
SISAFISKNKDIQEEEADEDEDEDAAFAKARRDSESFQMPQLDEIEQAKL
SSCVDEVRSVVGDAVSERRIVETSMKFDYDMQKILDEILNEETNKSAKPA
VNKMKAPAAPVLPKTVSKTVPTPPPKISLKEPRRGFEIPSPKVPSSPVVS
GRNTPVDISAGDDISRSSATVFKVSKEQAVRNARQLYEKERADQKSHIHM
IVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVL
DETGEERARGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQAD
VALLVVDATRGEFESGFELGGQTREHAILVRSLGVNQLGVVINKLDTVGW
SQDRFTEIVTKLKSFLKLAGFKDSDVSFTPCSGLTGENLTKKAQEPALTN
WYSGRHLLDVIENFKIPERAIDRPLRMSVSDIYKGTGSGFCISGRVETGV
LCLNDKVLVGASREQAQVKSLTMNEFPQTCVFAGDQVSVTLPALDINNVT
VGCIISDPQTPIPVTTRFQARIIVFNVKVPITMGFPVLLHHQSLIEPAVV
CKLTASIHKSTGEVVKKKPRCLGNNSCALVELETSRPICIERYADFKELG
RVMLRVAGVTIAAGMVTKIR*

FI04779.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
HBS1-PB 670 CG1898-PB 1..670 1..670 3431 100 Plus
HBS1-PA 670 CG1898-PA 1..670 1..670 3431 100 Plus
Elf-PB 619 CG6382-PB 85..617 149..669 806 34.6 Plus
Elf-PD 619 CG6382-PD 85..617 149..669 806 34.6 Plus
Elf-PA 619 CG6382-PA 85..617 149..669 806 34.6 Plus